IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The Arabidopsis NPR1/NIM1 protein enhances the DNA binding activity of a subgroup of the TGA family of bZIP transcription factors. The Arabidopsis NPR1/NIM1 protein enhances the DNA binding activity of a subgroup of the TGA family of bZIP transcription factors. Plant Cell (1040-4651) 2000 Despres C., DeLong C., Glaze S., Liu E., Fobert PR. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Despres C., DeLong C., Glaze S., Liu E., Fobert PR. Plant Cell (1040-4651) 2000 The Arabidopsis NPR1/NIM1 protein enhances the DNA binding activity of a subgroup of the TGA family of bZIP transcription factors. The Arabidopsis NPR1/NIM1 protein enhances the DNA binding activity of a subgroup of the TGA family of bZIP transcription factors. Plant Cell (1040-4651) 2000 Despres C., DeLong C., Glaze S., Liu E., Fobert PR. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Despres C., DeLong C., Glaze S., Liu E., Fobert PR. Directed yeast two hybrid Plant Cell (1040-4651) 2000 The Arabidopsis NPR1/NIM1 protein enhances the DNA binding activity of a subgroup of the TGA family of bZIP transcription factors. The Arabidopsis NPR1/NIM1 protein enhances the DNA binding activity of a subgroup of the TGA family of bZIP transcription factors. Plant Cell (1040-4651) 2000 Despres C., DeLong C., Glaze S., Liu E., Fobert PR. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Despres C., DeLong C., Glaze S., Liu E., Fobert PR. Plant Cell (1040-4651) 2000 tga7_arath Transcription factor TGA7 TGA7 BZIP50 At1g77920 F28K19.13 bZIP transcription factor 50 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMSSSSPTQLASLRDMGIYEPFQQIVGWGNVFKSDINDHSPNTATSSIIQVDPRIDDHNNNIKINYDSSHNQIEAEQPSSNDNQDDDGRIHDKMKRRLAQNREAARKSRLRKKAYVQQLEESRLKLSQLEQELEKVKQQGHLGPSGSINTGIASFEMEYSHWLQEQSRRVSELRTALQSHISDIELKMLVESCLNHYANLFQMKSDAAKADVFYLISGMWRTSTERFFQWIGGFRPSELLNVVMPYLQPLTDQQILEVRNLQQSSQQAEDALSQGIDKLQQSLAESIVIDAVIESTHYPTHMAAAIENLQALEGFVNQADHLRQQTLQQMAKILTTRQSARGLLALGEYLHRLRALSSLWAARPQEPT 3C6CBF4D070C2D0A tga2_arath Transcription factor TGA2 TGA2 BZIP20 HBP1B At5g06950 MOJ9.12 HBP-1b homolog bZIP transcription factor 20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADTSPRTDVSTDDDTDHPDLGSEGALVNTAASDSSDRSKGKMDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISGTGDQAHSTGGNGALAFDAEHSRWLEEKNKQMNELRSALNAHAGDSELRIIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQLMGINNLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTLQQMIRVLTTRQSARALLAIHDYFSRLRALSSLWLARPRE D3033153BCE932C4 tga4_arath Transcription factor TGA4 Ocs element-binding factor 4 TGA4 BZIP57 OBF4 At5g10030 T31P16_20 bZIP transcription factor 57 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNTTSTHFVPPRRFEVYEPLNQIGMWEESFKNNGDMYTPGSIIIPTNEKPDSLSEDTSHGTEGTPHKFDQEASTSRHPDKIQRRLAQNREAARKSRLRKKAYVQQLETSRLKLIHLEQELDRARQQGFYVGNGVDTNALSFSDNMSSGIVAFEMEYGHWVEEQNRQICELRTVLHGQVSDIELRSLVENAMKHYFQLFRMKSAAAKIDVFYVMSGMWKTSAERFFLWIGGFRPSELLKVLLPHFDPLTDQQLLDVCNLRQSCQQAEDALSQGMEKLQHTLAESVAAGKLGEGSYIPQMTCAMERLEALVSFVNQADHLRHETLQQMHRILTTRQAARGLLALGEYFQRLRALSSSWAARQREPT 08225A91F4CA20ED tga1_arath Transcription factor TGA1 DNA-binding protein TGA1a-like protein TGA1 BZIP47 At5g65210 MQN23.15 bZIP transcription factor 47 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNSTSTHFVPPRRVGIYEPVHQFGMWGESFKSNISNGTMNTPNHIIIPNNQKLDNNVSEDTSHGTAGTPHMFDQEASTSRHPDKIQRRLAQNREAARKSRLRKKAYVQQLETSRLKLIQLEQELDRARQQGFYVGNGIDTNSLGFSETMNPGIAAFEMEYGHWVEEQNRQICELRTVLHGHINDIELRSLVENAMKHYFELFRMKSSAAKADVFFVMSGMWRTSAERFFLWIGGFRPSDLLKVLLPHFDVLTDQQLLDVCNLKQSCQQAEDALTQGMEKLQHTLADCVAAGQLGEGSYIPQVNSAMDRLEALVSFVNQADHLRHETLQQMYRILTTRQAARGLLALGEYFQRLRALSSSWATRHREPT 8EB9CD75E1E1EF39 q8l9w4_arath NPR1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDTTIDGFADSYEISSTSFVATDNTDSSIVYLAAEQVLTGPDVSALQLLSNSFESVFDSPDDFYSDAKLVLSDGREVSFHRCVLSARSSFFKSALAAAKKEKDSNNTAAVKLELKEIAKDYEVGFDSVVTVLAYVYSSRVRPPPKGVSECADENCCHVACRPAVDFMLEVLYLAFIFRIPELVTLYQRHLLDVVDKVVIEDTLVILKLANICGKACMKLLDRCKEIIVKSNVDMVSLEKSLPEELVKEIIDRRKELGLEVPKVKKHVSNVHKALDSDDIELVKLLLKEDHTNLDDACALHFAVAYCNVKTATDLLKLDLADVNHRNPRGYTVLHVAAMRKEPQLILSLLEKGASASEATLEGRTALMIAKQATMAVECNNIPEQCKHSLKGRLCVEILEQEDKREPIPRDVPPSFAVAADELKMTLLDLENRVALAQRLFPTEAQAAMEIAEMKGTCEFIVTSLEPDRLTGTKRTSPGVKIAPFRILEEHQSRLKALSKTVELGKRFFPRCSAVLDQIMNCEDLTQLACGEDDTAEKRLQKKQRYMEIQETLKKAFSEDNLELGNSSLTDSTSSTSKSTGGKRSNRKFSHRRR A97B8448176E35E8 tga6_arath Transcription factor TGA6 TGA6 BZIP45 At3g12250 F28J15.6 MQC3.8 bZIP transcription factor 45 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADTSSRTDVSTDGDTDHRDLGSDRGHMHAAASDSSDRSKDKLDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTGGNGALAFDAEHSRWLEEKNRQMNELRSALNAHAGDTELRIIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQVMGINSLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSSSSDNVASYMGQMAMAMGQLGTLEGFIRQADNLRLQTLQQMLRVLTTRQSARALLAIHDYSSRLRALSSLWLARPRE 2A55F2F336648A48 tga3_arath Transcription factor TGA3 TGA3 BZIP22 At1g22070 F2E2.14 bZIP transcription factor 22 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEMMSSSSSTTQVVSFRDMGMYEPFQQLSGWESPFKSDINNITSNQNNNQSSSTTLEVDARPEADDNNRVNYTSVYNNSLEAEPSSNNDQDEDRINDKMKRRLAQNREAARKSRLRKKAHVQQLEESRLKLSQLEQELVRARQQGLCVRNSSDTSYLGPAGNMNSGIAAFEMEYTHWLEEQNRRVSEIRTALQAHIGDIELKMLVDSCLNHYANLFRMKADAAKADVFFLMSGMWRTSTERFFQWIGGFRPSELLNVVMPYVEPLTDQQLLEVRNLQQSSQQAEEALSQGLDKLQQGLVESIAIQIKVVESVNHGAPMASAMENLQALESFVNQADHLRQQTLQQMSKILTTRQAARGLLALGEYFHRLRALSSLWAARPREHT 48F965F62A2980A9 tga5_arath Transcription factor TGA5 TGA5 BZIP26 OBF5 At5g06960 MOJ9.13 Ocs element-binding factor 5 bZIP transcription factor 26 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGDTSPRTSVSTDGDTDHNNLMFDEGHLGIGASDSSDRSKSKMDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTAGDGAMAFDVEYRRWQEDKNRQMKELSSAIDSHATDSELRIIVDGVIAHYEELYRIKGNAAKSDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLIASQLEPLTEQQSLDINNLQQSSQQAEDALSQGMDNLQQSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTYQQMVRLLTTRQSARALLAVHNYTLRLRALSSLWLARPRE 645062F0F3351869 npr1-tga1 1 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association npr1-tga3 1 8 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association npr1-tga5 1 8 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association npr1-tga6-1 1 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association npr1-tga7 1 4 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association npr1-tga3-1 2 8 unspecified role unspecified role bait bait Q8L9W4:p.His300Tyr Histidine 300 tyrosine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H Y Wed May 02 15:23:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his300tyr' Tue Jun 30 18:34:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His300Tyr' 10 unspecified role unspecified role prey prey physical association physical association npr1-tga2-1 2 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait Q8L9W4:p.His300Tyr Histidine 300 tyrosine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H Y Wed May 02 19:17:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his300tyr' Tue Jun 30 15:59:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His300Tyr' physical association physical association npr1-tga2-2 3 5 unspecified role unspecified role prey prey s35 radiolabelled radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait Q8L9W4:p.His300Tyr Histidine 300 tyrosine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H Y Wed May 02 15:51:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his300tyr' Tue Jun 30 19:14:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His300Tyr' biotinylated tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association npr1-tga4 3 6 unspecified role unspecified role prey prey s35 radiolabelled radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait Q8L9W4:p.His300Tyr Histidine 300 tyrosine mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H Y Wed May 02 18:32:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his300tyr' Tue Jun 30 20:15:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His300Tyr' biotinylated tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association The authors note that the interaction between TGA4 and NPR1 detected using this assay was weak (sic) which possibly explained the failure to detect this interaction using yeast-2-hybrid assay.