MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Ropporin, a sperm-specific binding protein of rhophilin, that is localized in the fibrous sheath of sperm flagella. Ropporin, a sperm-specific binding protein of rhophilin, that is localized in the fibrous sheath of sperm flagella. J. Cell. Sci. (0021-9533) 2000 Fujita A., Nakamura K., Kato T., Watanabe N., Ishizaki T., Kimura K., Mizoguchi A., Narumiya S. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Fujita A., Nakamura K., Kato T., Watanabe N., Ishizaki T., Kimura K., Mizoguchi A., Narumiya S. J. Cell. Sci. (0021-9533) 2000 Ropporin, a sperm-specific binding protein of rhophilin, that is localized in the fibrous sheath of sperm flagella. Ropporin, a sperm-specific binding protein of rhophilin, that is localized in the fibrous sheath of sperm flagella. J. Cell. Sci. (0021-9533) 2000 Fujita A., Nakamura K., Kato T., Watanabe N., Ishizaki T., Kimura K., Mizoguchi A., Narumiya S. in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Fujita A., Nakamura K., Kato T., Watanabe N., Ishizaki T., Kimura K., Mizoguchi A., Narumiya S. no J. Cell. Sci. (0021-9533) 2000 rop1_mouse Ropporin-1 Ropn1 Rhophilin-associated protein 1 Rhophilin-associated 'oppo' protein protein protein mouse Mus musculus Mouse MPQTDKQVCIPPELPELLKQFTKDAIRTQPPDLIQWAAEYFGAMSRGEIPPVRERSEQIPLSNWAELTPELLKVLHSRVAGRLIIHADELAQMWKVLNLPTDLFNSVMNVGRFTEEIEWLKFLALACSSLGVTIAKTLKIVCEVLSSDHDGGPPRIPFSTFQFLYTYIAEVDGEISSSHVSRMLNYIEQEVIGPDGLIKVNDFTQNPRVRLE mint 782EA4C6890BC50C rhpn1_mouse Rhophilin-1 Rhpn1 Grbp GTP-Rho-binding protein 1 protein protein mouse Mus musculus Mouse MILEERPDGQGTGEESSRPQDDGSIRKGYGSFVQNQPGQLQSHRARLHQQISKELRMRTGAENLYRATSNTWVRETVALELSYVNSNLQLLKEELAELSTSVDVDQPEGEGITIPMIPLGLKETKELDWATPLKELISEHFGEDGTSFETEIQELEDLRQATRTPSRDEAGLDLLAAYYSQLCFLDARFFSPSRSPGLLFHWYDSLTGVPAQQRALAFEKGSVLFNIGALHTQIGARQDCSCTEGTNHAAEAFQRAAGAFRLLRENFSHAPSPDMSAASLSMLEQLMIAQAQECIFKGLLLPASATPDICPDQLQLAQEAAQVATEYGLVHRAMAQPPVRDYLPASWTNLAHVKAEHFCALAHYHAAMALCESHPAKGELARQEHVFQPSTPHEPLGPTLPQHPEDRRKLAKAHLKRAILGQEEALRLHTLCRVLRKVDLLQVVVTQALRRSLAKYSQLEREDDFFEATEAPDIQPKTHQTPEGPLSVFSTKNRWQLVGPVHMTRGEGSFGFTLRGDSPVLIAAVVPGGQAESAGLKEGDYIVSVNGQPCKWWKHLEVVTQLRSMGEEGVSLQVVSLLPSPEPRGTGPRRAALLWNQRECGFETPMPTRTRPWPILGWSRKNKQGKTGSHPDPCTNRNCVTCP mint Has no enzymatic activity. May serve as a target for Rho, and interact with some cytoskeletal component upon Rho binding or relay a Rho signal to other molecules 4D964E14069CCA5C rhpn1-ropn1 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range MINT-377780: original sequence: 499-643 : GPVHMTRGEGGFGFTLRGDSPVLIAAVVPGGQAESAGLKEGDYIVSVNGQPCKWWKHLEVVTQLRSMGEEGVSLQVVSLLPSPEPRGTGPRRAALLWNQRECGFETPMPTRTRPWPILGWSRKNKQGKTGSHPDPCTNRNCVTC [EBI-7153526]The shifted ranges (499-643) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-7153526]499-643 [EBI-7153526]Q61085,1 tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F1C PDZ mint ropn1-ropn1 1 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain range MINT-377759: original sequence: 1-60 : MPQTDKQVCIPPELPELLKQFTKDAIRTQPPDLIQWAAEYFGAMSRGEIPPVRERSEQI tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-377768: original sequence: 1-212 : MPQTDKQVCIPPELPELLKQFTKDAIRTQPPDLIQWAAEYFGAMSRGEIPPVRERSEQIPLSNWAELTPELLKVLHSRVAGRLIIHADELAQMWKVLNLPTDLFNSVMNVGRFTEEIEWLKFLALACSSLGVTIAKTLKIVCEVLSSDHDGGPPRIPFSTFQFLYTYIAEVDGEISSSHVSRMLNYIEQEVIGPDGLIKVNDFTQNPRVRL tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F4A F4B PDZ homomint mint rhpn1-ropn1-1 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range MINT-377736: original sequence: 499-643 : GPVHMTRGEGGFGFTLRGDSPVLIAAVVPGGQAESAGLKEGDYIVSVNGQPCKWWKHLEVVTQLRSMGEEGVSLQVVSLLPSPEPRGTGPRRAALLWNQRECGFETPMPTRTRPWPILGWSRKNKQGKTGSHPDPCTNRNCVTC [EBI-7153659]The shifted ranges (499-643) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-7153659]499-643 [EBI-7153659]Q61085,1 Stoichiometry: 1.0 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal range MINT-377746: original sequence: 208-212 : IKVNDFTQNPRVRL Stoichiometry: 1.0 physical association physical association F5 PDZ mint rhpn1-ropn1-2 2 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range MINT-377802: original sequence: 499-643 : GPVHMTRGEGGFGFTLRGDSPVLIAAVVPGGQAESAGLKEGDYIVSVNGQPCKWWKHLEVVTQLRSMGEEGVSLQVVSLLPSPEPRGTGPRRAALLWNQRECGFETPMPTRTRPWPILGWSRKNKQGKTGSHPDPCTNRNCVTC [EBI-7153690]The shifted ranges (499-643) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-7153690]499-643 [EBI-7153690]Q61085,1 Stoichiometry: 1.0 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3A PDZ mint