IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structure of the small G protein Cdc42 bound to the GTPase-binding domain of ACK. Structure of the small G protein Cdc42 bound to the GTPase-binding domain of ACK. Nature (0028-0836) 1999 Mott HR., Owen D., Nietlispach D., Lowe PN., Manser E., Lim L., Laue ED. in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Mott HR., Owen D., Nietlispach D., Lowe PN., Manser E., Lim L., Laue ED. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Nature (0028-0836) 1999 p60953-2 Cell division control protein 42 homolog CDC42 G25K GTP-binding protein Placental protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL DIP protein P60953-2 original sequence version: 152 DIP protein P60953 original sequence version: 98 DIP protein P60953 original sequence version: 148 DIP protein P60953 original sequence version: 142 DIP protein P60953-2 original sequence version: 135 DIP protein P60953 original sequence version: 99 DIP protein P60953-2 original sequence version: 139 DIP protein P60953 original sequence version: 144 DIP protein P60953 original sequence version: 163 DIP protein P60953 original sequence version: 158 DIP protein P60953-2 original sequence version: 147 DIP protein P60953 original sequence version: 123 51A437E22A4D8FFF ack1_human Activated CDC42 kinase 1 ACK1 TNK2 Tyrosine kinase non-receptor protein 2 protein protein human Homo sapiens Human MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLWEAVKRRKALCKRKSWMSKVFSGKRLEAEFPPHHSQSTFRKTSPAPGGPAGEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRAENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPLQNSFIHTGHGDSDPRHCWGFPDRIDELYLGNPMDPPDLLSVELSTSRPPQHLGGVKKPTYDPVSEDQDPLSSDFKRLGLRKPGLPRGLWLAKPSARVPGTKASRGSGAEVTLIDFGEEPVVPALRPCAPSLAQLAMDACSLLDETPPQSPTRALPRPLHPTPVVDWDARPLPPPPAYDDVAQDEDDFEICSINSTLVGAGVPAGPSQGQTNYAFVPEQARPPPPLEDNLFLPPQGGGKPPSSAQTAEIFQALQQECMRQLQAPAGSPAPSPSPGGDDKPQVPPRVPIPPRPTRPHVQLSPAPPGEEETSQWPGPASPPRVPPREPLSPQGSRTPSPLVPPGSSPLPPRLSSSPGKTMPTTQSFASDPKYATPQVIQAPGPRAGPCILPIVRDGKKVSSTHYYLLPERPSYLERYQRFLREAQSPEEPTPLPVPLLLPPPSTPAPAAPTATVRPMPQAALDPKANFSTNNSNPGARPPPPRATARLPQRGCPGDGPEAGRPADKIQMAMVHGVTTEECQAALQCHGWSVQRAAQYLKVEQLFGLGLRPRGECHKVLEMFDWNLEQAGCHLLGSWGPAHHKR DIP protein Q07912 original sequence version: 150 DIP protein Q07912 original sequence version: 117 74A1980665BC3E6B wasp-ack1-1 1 3 unspecified role unspecified role neutral component neutral component gbd binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain his464 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain phe462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain phe462 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain asp38 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain val42 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ile21 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P60953-2:p.Glu62Leu mutation mutation certain certain sequence position certain certain certain sequence position certain E L Wed May 02 14:35:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu62leu' Tue Jun 30 19:36:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu62Leu' ecoli Escherichia coli (strain K12) 12 7 9 14 13 8 direct interaction direct interaction Cdc42 Q61L is constitutively active and bound to GMPPNP