IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Simultaneous binding of two protein kinases to a calcium-dependent potassium channel. Simultaneous binding of two protein kinases to a calcium-dependent potassium channel. J. Neurosci. (0270-6474) 1999 Wang J., Zhou Y., Wen H., Levitan IB. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang J., Zhou Y., Wen H., Levitan IB. J. Neurosci. (0270-6474) 1999 Simultaneous binding of two protein kinases to a calcium-dependent potassium channel. Simultaneous binding of two protein kinases to a calcium-dependent potassium channel. J. Neurosci. (0270-6474) 1999 Wang J., Zhou Y., Wen H., Levitan IB. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Wang J., Zhou Y., Wen H., Levitan IB. The GST tagged protein was electrophresed and immobilised on a nitrocellulose membrane and then probed with biotinylated PKAc. Immunoprecipitation was followed by analysis for tyrosine phosphorylation. J. Neurosci. (0270-6474) 1999 Simultaneous binding of two protein kinases to a calcium-dependent potassium channel. Simultaneous binding of two protein kinases to a calcium-dependent potassium channel. J. Neurosci. (0270-6474) 1999 Wang J., Zhou Y., Wen H., Levitan IB. drome Drosophila melanogaster (Fruit fly) Fruit fly anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang J., Zhou Y., Wen H., Levitan IB. Immunoprecipitation was followed by analysis for tyrosine phosphorylation. J. Neurosci. (0270-6474) 1999 Simultaneous binding of two protein kinases to a calcium-dependent potassium channel. Simultaneous binding of two protein kinases to a calcium-dependent potassium channel. J. Neurosci. (0270-6474) 1999 Wang J., Zhou Y., Wen H., Levitan IB. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang J., Zhou Y., Wen H., Levitan IB. Immunoprecipitation was followed by analysis for tyrosine phosphorylation. J. Neurosci. (0270-6474) 1999 kapc1_drome cAMP-dependent protein kinase catalytic subunit 1 Pka-C1 CdkA DC0 Protein kinase DC0 CG4379 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MGNNATTSNKKVDAAETVKEFLEQAKEEFEDKWRRNPTNTAALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKEFAEF 9611D1001C791874 src64_drome Tyrosine-protein kinase Src64B Src64B Src1 CG7524 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MGNKCCSKRQDQELALAYPTGGYKKSDYTFGQTHINSSGGGNMGGVLGQKHNNGGSLDSRYTPDPNHRGPLKIGGKGGVDIIRPRTTPTGVPGVVLKRVVVALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAEERSVNSEDWFFENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHVKHYRIKPLDNGGYYIATNQTFPSLQALVMAYSKNALGLCHILSRPCPKPQPQMWDLGPELRDKYEIPRSEIQLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQEEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKICDFGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSREVIENIERGFRMPKPTNHYFPDNIYQLLLQCWDAVPEKRPTFEFLNHYFESFSVTSEVPYREVQD DIP protein P00528 original sequence version: 104 4A63CF4F16562864 slo_drome Calcium-activated potassium channel slowpoke Maxi K channel BK channel slo CG10693 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MASGLIDTNFSSTLANGMSGCDQSTVESLADDPTDSPFDADDCLKVRKYWCFLLSSIFTFLAGLLVVLLWRAFAFVCCRKEPDLGPNDPKQKEQKASRNKQEFEGTFMTEAKDWAGELISGQTTTGRILVVLVFILSIASLIIYFVDASSEEVERCQKWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPLDFNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAMFASSIPEIIELVGSGNKYGGELKREHGKRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGTIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPDMQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQATELCFSKLKLLLLAIEIKGAEEGADSKISINPRGAKIQANTQGFFIAQSADEVKRAWFYCKACHEDIKDETLIKKCKCKNLTVQPRSKFDDLDEHHPAPTFTPPELPKRVHVRGSVSGDITRDREDTNLLNRNVRRPNGTGNGTGGMHHMNNTAAAAAAAAAAGKQVNKVKPTVNVSRQVEGQVISPSQYNRPTSRSSGTGTQNQNGGVSLPAGIADDQSKDFDFEKTEMKYDSTGMFHWSPAKSLEDCILDRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELKHVVIVGSVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKVPSNDDPTLADKEAILASLNIKAMTFDDTIGVLSQRGPEFDNLSATAGSPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQISLYDGPLAQFGECGKYGDLFVAALKSYGMLCIGLYRFRDTSSSCDASSKRYVITNPPDDFSLLPTDQVFVLMQFDPGLEYKPPAVRAPAGGRGTNTQGSGVGGGGSNKDDNS 306A12234C63AD0D pka_c1-slo-1 1 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association src64b-slo-2 1 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association src64b-pka_c1-3 1 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association pka_c1-slo-2 1 5 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association src64b-slo-3 4 7 enzyme target enzyme target substrate substrate unspecified role unspecified role 6 enzyme enzyme unspecified role unspecified role phosphorylation phosphorylation reaction phosphorylation Tyrosine phosphorylation of Slo observed. src64b-slo-4 3 6 enzyme enzyme unspecified role unspecified role 7 enzyme target enzyme target substrate substrate unspecified role unspecified role phosphorylation phosphorylation reaction phosphorylation Tyrosine phosphorylation of Slo observed. pka_c1-slo-4 3 5 enzyme enzyme unspecified role unspecified role 7 enzyme target enzyme target substrate substrate unspecified role unspecified role phosphorylation phosphorylation reaction phosphorylation Phosphorylation of S942 of Slo observed. pka_c1-slo-3 4 7 enzyme target enzyme target substrate substrate unspecified role unspecified role 5 enzyme enzyme unspecified role unspecified role phosphorylation phosphorylation reaction phosphorylation Phosphorylation of S942 of Slo observed. pka_c1-slo-5 2 5 unspecified role unspecified role prey prey biotin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association