MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The crystal structure of horse deoxyhaemoglobin trapped in the high-affinity (R) state. The crystal structure of horse deoxyhaemoglobin trapped in the high-affinity (R) state. J. Mol. Biol. (0022-2836) 1996 Wilson J., Phillips K., Luisi B. no in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Wilson J., Phillips K., Luisi B. no J. Mol. Biol. (0022-2836) 1996 hba_equpr Hemoglobin subunit alpha HBA Hemoglobin alpha chain Alpha-globin protein protein equpr Equus caballus przewalskii MVLSAADKTNVKAAWSKVGGHAGEFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVSTVLTSKYR mint Involved in oxygen transport from the lung to the various peripheral tissues 93BB916115C1D173 hbb_horse Hemoglobin subunit beta HBB Hemoglobin beta chain Beta-globin protein protein horse Equus caballus (Horse) Horse VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDKLHVDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVANALAHKYH mint Involved in oxygen transport from the lung to the various peripheral tissues 734664793DA642EE hba-hbb-8 1 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction In the xray complex 1ibe, Q9XSE9 is chain A and P02062 is chain B Resolution 1.800 mint