MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Three-dimensional structure of a hybrid light chain dimer: protein engineering of a binding cavity. Three-dimensional structure of a hybrid light chain dimer: protein engineering of a binding cavity. Mol. Immunol. (0161-5890) 1990 Ely KR., Herron JN., Edmundson AB. no in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ely KR., Herron JN., Edmundson AB. no Mol. Immunol. (0161-5890) 1990 lv208_human Immunoglobulin lambda variable 2-8 IGLV2-8 Ig lambda chain V-II region BO Ig lambda chain V-II region MGC protein protein human Homo sapiens Human MAWALLLLTLLTQGTGSWAQSALTQPPSASGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVSKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYAGSNNF mint B94EEE11F9DA8260 iglc1_human Immunoglobulin lambda constant 1 IGLC1 Ig lambda chain C region MGC Ig lambda-1 chain C region protein protein human Homo sapiens Human GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS 4BA84D404ECA997E iglc1-lv206 1 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction In the xray complex 1mcw, P01709 is chain M and P01842 is chain W Resolution 3.500 homomint mint