IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural basis for inhibition of the replication licensing factor Cdt1 by geminin. Structural basis for inhibition of the replication licensing factor Cdt1 by geminin. Nature (0028-0836) 2004 Lee C., Hong B., Choi JM., Kim Y., Watanabe S., Ishimi Y., Enomoto T., Tada S., Kim Y., Cho Y. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lee C., Hong B., Choi JM., Kim Y., Watanabe S., Ishimi Y., Enomoto T., Tada S., Kim Y., Cho Y. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Nature (0028-0836) 2004 gemi_mouse Geminin Gmnn protein protein mouse Mus musculus Mouse MNLSMKQKQEGAQENVKNSPVPRRTLKMIQPSADGSLVGRENELPKGLFKRKLWDDQLASQTSSCGPEANENKDVGDLTQEAFDLISKENPSSQYWKEVAEQRRKALYEALKENEKLHKEIEQKDSEIARLRKENKDLAEVAEHVQYMAEVIERLSNEPLDNFESPDSQEFDSEEEAVEYSELEDSGAGTCAEETVSSSTDARPCT DIP protein O88513 original sequence version: 112 DIP protein O88513 original sequence version: 104 B87153A5D5BCF5CF cdt1_mouse DNA replication factor Cdt1 Double parked homolog Retroviral insertion site 2 protein Cdt1 Ris2 protein protein mouse Mus musculus Mouse MAQSRVTDFYACRRPGLTTPRAKSICLTPSPGGLVAPAFTRSSSRKRARPPAEPGSDQPAPLARRRLRLPGLDSCPSSLPEPSSPAEPSPPADPSPPADPGSPVCPSPVKRTKSTTVYVGQQPGKIPSEDSVSELQSCLRRARKLGAQARALRARVQENAVEPSTPDAKVPTEQPCVEKAPAYQRFHALAQPGLPGLVLPYKYQVLVEMFRSMDTIVSMLHNRSETVTFAKVKQGVQEMMRKRFEERNVGQIKTVYPTSYRFRQECNVPTFKDSIKRSDYQLTIEPLLGQEAGGATQLTATCLLQRRQVFRQNLVERVKEQHKVFLASLNPPMAVPDDQLTRWHPRFNVDEVPDIEPAELPQPPVTEKLTTAQEVLARARSLMTPKMEKALSNLALRSAEPGSPGTSTPPLPATPPATPPAASPSALKGVSQALLERIRAKEVQKQLARMTRCPEQELRLQRLERLPELARVLRNVFVSERKPALTMEVVCARMVDSCQTALSPGEMEKHLVLLAELLPDWLSLHRIRTDTYVKLDKAVDLAGLTARLAHHVHAEGL BFBA4E6DB5ABC1E6 ctd1-gmnn-8 1 3 unspecified role unspecified role neutral component neutral component region Binding region of CTD1 binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 2 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 6 8 direct interaction direct interaction 2.80 working 23.1%, free 28.5%