MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Increase of SUMO-1 expression in response to hypoxia: direct interaction with HIF-1alpha in adult mouse brain and heart in vivo. Increase of SUMO-1 expression in response to hypoxia: direct interaction with HIF-1alpha in adult mouse brain and heart in vivo. FEBS Lett. (0014-5793) 2004 imex curation Shao R., Zhang FP., Tian F., Anders Friberg P., Wang X., Sjoland H., Billig H. no For the second round of immunoblotting, the blot was stripped and reprobed. Only protein-protein interactions mouse-heart Mus musculus heart [Cardiac; Cardiac tissue] heart Heart [Cardiac; Cardiac tissue] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shao R., Zhang FP., Tian F., Anders Friberg P., Wang X., Sjoland H., Billig H. no For the second round of immunoblotting, the blot was stripped and reprobed. FEBS Lett. (0014-5793) 2004 Only protein-protein interactions imex curation Increase of SUMO-1 expression in response to hypoxia: direct interaction with HIF-1alpha in adult mouse brain and heart in vivo. Increase of SUMO-1 expression in response to hypoxia: direct interaction with HIF-1alpha in adult mouse brain and heart in vivo. FEBS Lett. (0014-5793) 2004 imex curation Shao R., Zhang FP., Tian F., Anders Friberg P., Wang X., Sjoland H., Billig H. no For the second round of immunoblotting, the blot was stripped and reprobed. Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] imaging technique imaging technique microscopy immunostaining immunostaining Shao R., Zhang FP., Tian F., Anders Friberg P., Wang X., Sjoland H., Billig H. no For the second round of immunoblotting, the blot was stripped and reprobed. FEBS Lett. (0014-5793) 2004 Only protein-protein interactions imex curation Increase of SUMO-1 expression in response to hypoxia: direct interaction with HIF-1alpha in adult mouse brain and heart in vivo. Increase of SUMO-1 expression in response to hypoxia: direct interaction with HIF-1alpha in adult mouse brain and heart in vivo. FEBS Lett. (0014-5793) 2004 imex curation Shao R., Zhang FP., Tian F., Anders Friberg P., Wang X., Sjoland H., Billig H. no For the second round of immunoblotting, the blot was stripped and reprobed. Only protein-protein interactions mouse-heart Mus musculus heart [Cardiac; Cardiac tissue] heart Heart [Cardiac; Cardiac tissue] imaging technique imaging technique microscopy immunostaining immunostaining Shao R., Zhang FP., Tian F., Anders Friberg P., Wang X., Sjoland H., Billig H. no For the second round of immunoblotting, the blot was stripped and reprobed. FEBS Lett. (0014-5793) 2004 Only protein-protein interactions imex curation Increase of SUMO-1 expression in response to hypoxia: direct interaction with HIF-1alpha in adult mouse brain and heart in vivo. Increase of SUMO-1 expression in response to hypoxia: direct interaction with HIF-1alpha in adult mouse brain and heart in vivo. FEBS Lett. (0014-5793) 2004 imex curation Shao R., Zhang FP., Tian F., Anders Friberg P., Wang X., Sjoland H., Billig H. no For the second round of immunoblotting, the blot was stripped and reprobed. Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shao R., Zhang FP., Tian F., Anders Friberg P., Wang X., Sjoland H., Billig H. no For the second round of immunoblotting, the blot was stripped and reprobed. FEBS Lett. (0014-5793) 2004 Only protein-protein interactions imex curation hif1a_mouse Hypoxia-inducible factor 1-alpha Hif1a ARNT-interacting protein protein protein mouse Mus musculus Mouse MEGAGGENEKKKMSSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGGLDSEDEMKAQMDCFYLKALDGFVMVLTDDGDMVYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGPVRKGKELNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTESVLKPVESSDMKMTQLFTKVESEDTSCLFDKLKKEPDALTLLAPAAGDTIISLDFGSDDTETEDQQLEDVPLYNDVMFPSSNEKLNINLAMSPLPSSETPKPLRSSADPALNQEVALKLESSPESLGLSFTMPQIQDQPASPSDGSTRQSSPERLLQENVNTPNFSQPNSPSEYCFDVDSDMVNVFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESNSPSPPSMSTVTGFQQTQLQKPTITATATTTATTDESKTETKDNKEDIKILIASPSSTQVPQETTTAKASAYSGTHSRTASPDRAGKRVIEQTDKAHPRSLNLSATLNQRNTVPEEELNPKTIASQNAQRKRKMEHDGSLFQAAGIGTLLQQPGDCAPTMSLSWKRVKGFISSEQNGTEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN 84D64ECAC2CC753B sumo1_mouse Small ubiquitin-related modifier 1 Sumo1 Smt3c Smt3h3 Ubl1 Ubiquitin-like protein SMT3C SMT3 homolog 3 Ubiquitin-homology domain protein PIC1 protein protein mouse Mus musculus Mouse MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV DIP protein P63166 original sequence version: 51 DIP protein P63166 original sequence version: 69 DIP protein P63166 original sequence version: 82 DIP protein P63166 original sequence version: 35 89BE97D2D054FB33 hif1a-sumo1-1 1 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Interaction occurs in response to hypoxic stimulation. hif1a-sumo1-2 1 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Interaction occurs in response to hypoxic stimulation. hif1a-sumo1-3 4 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Interaction occurs in response to hypoxic stimulation. hif1a-sumo1-4 4 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Interaction occurs in response to hypoxic stimulation. hif1a-sumo1-5 3 6 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component colocalization colocalization hif1a-sumo1-6 2 6 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component colocalization colocalization