IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A novel mode of RBD-protein recognition in the Y14-Mago complex. A novel mode of RBD-protein recognition in the Y14-Mago complex. Nat. Struct. Biol. (1072-8368) 2003 Fribourg S., Gatfield D., Izaurralde E., Conti E. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Fribourg S., Gatfield D., Izaurralde E., Conti E. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Nat. Struct. Biol. (1072-8368) 2003 A novel mode of RBD-protein recognition in the Y14-Mago complex. A novel mode of RBD-protein recognition in the Y14-Mago complex. Nat. Struct. Biol. (1072-8368) 2003 Fribourg S., Gatfield D., Izaurralde E., Conti E. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Fribourg S., Gatfield D., Izaurralde E., Conti E. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Nat. Struct. Biol. (1072-8368) 2003 mgn_human Protein mago nashi homolog MAGOH MAGOHA protein protein human Homo sapiens Human MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI DIP protein P61326 original sequence version: 113 DIP protein P61326 original sequence version: 114 DIP protein P61326 original sequence version: 78 DIP protein P61326 original sequence version: 91 DIP protein P61326 original sequence version: 100 FFAD0B075E045875 rbm8a_drome RNA-binding protein 8A tsu Y14 CG8781 Protein tsunagi protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MADVLDIDNAEEFEVDEDGDQGIVRLKEKAKHRKGRGFGSDSNTREAIHSYERVRNEDDDELEPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKGPKRVKKSEKRRR A47BE9ED37CCA045 rbm8a_human RNA-binding protein 8A HSPC114 MDS014 RNA-binding motif protein 8A Ribonucleoprotein RBM8A RNA-binding protein Y14 Binder of OVCA1-1 RBM8A RBM8 protein protein human Homo sapiens Human MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR 70BBD03CDDFEECFE mgn_drome Protein mago nashi mago mgn CG9401 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSTEDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEAFVHQSVMEELKRIIIDSEIMQEDDLPWPPPDRVGRQELEIVIGDEHISFTTSKTGSLVDVNRSKDPEGLRCFYYLVQDLKCLVFSLIGLHFKIKPI B9A2CBFCC5EBEFED mago-tsu-2 2 4 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association 2.50 working 22.4%, free 27.2% mago-tsu-3 1 3 unspecified role unspecified role prey prey P61326:p.Leu136Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L R Wed May 02 15:13:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu136arg' Tue Jun 30 17:06:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu136Arg' n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) physical association physical association mago-tsu-4 1 5 unspecified role unspecified role prey prey n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9Y5S9:p.Leu118Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L R Wed May 02 14:39:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu118arg' Tue Jun 30 16:11:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu118Arg' region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) physical association physical association