IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ 14-3-3 regulates actin dynamics by stabilizing phosphorylated cofilin. 14-3-3 regulates actin dynamics by stabilizing phosphorylated cofilin. Curr. Biol. (0960-9822) 2002 Gohla A., Bokoch GM. in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom predetermined predetermined participant predetermined Gohla A., Bokoch GM. 14-3-3 is biotinylated and couples to streptavidin-agarose beads Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Curr. Biol. (0960-9822) 2002 14-3-3 regulates actin dynamics by stabilizing phosphorylated cofilin. 14-3-3 regulates actin dynamics by stabilizing phosphorylated cofilin. Curr. Biol. (0960-9822) 2002 Gohla A., Bokoch GM. in vitro In vitro biochemical biochemical fingerprinting peptide massfingerprinting fingerprinting Gohla A., Bokoch GM. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Curr. Biol. (0960-9822) 2002 14-3-3 regulates actin dynamics by stabilizing phosphorylated cofilin. 14-3-3 regulates actin dynamics by stabilizing phosphorylated cofilin. Curr. Biol. (0960-9822) 2002 Gohla A., Bokoch GM. in vitro In vitro pull down pull down polyclonal western polyclonal antibody western blot polyclonal western Gohla A., Bokoch GM. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Curr. Biol. (0960-9822) 2002 limk1_human LIM domain kinase 1 LIMK1 LIMK protein protein human Homo sapiens Human MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTPSGEAGSSARQKPVLRSCSIDRSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD DIP protein P53667 original sequence version: 113 9838BEFBE7006447 cof1a_xenla Cofilin-1-A cfl1-a ADF/cofilin-1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MASGVMVSDDVIKVFNEMKVRHQLSPEDAKKRKKAVVFCLSDDKKTIILEPGKEILQGDIGCNVEDPYKTFVKMLPRNDCRYALYDALYETKETKKEDLVFVFWAPEEASLKSKMIYASSKDAIKKRLPGIKHEWQINTYEDVNDPCNLADKLGGNTVVSLEGKSVRS F3A4D8635A3683D6 cof1_human Cofilin-1 CFL1 CFL Cofilin, non-muscle isoform 18 kDa phosphoprotein protein protein human Homo sapiens Human MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL DIP protein P23528 original sequence version: 124 DIP protein P23528 original sequence version: 172 589EF8FC1EC13719 1433z_bovin 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 Factor activating exoenzyme S protein protein bovin Bos taurus (Bovine) Bovine MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN D464DF2286BBFE60 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN DIP protein P63104 original sequence version: 144 D464DF2286BBFE60 ywhaz-xac1 2 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait phosphotylated ser3 required phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain P45695:p.Ser3Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 16:13:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser3ala' Tue Jun 30 16:49:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser3Ala' ecoli Escherichia coli (strain K12) physical association physical association cofilin is purified from bovine brain cytosol ywhaz-cof1-2 1 6 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined iodine125 radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association Kd is estimated using the best fit: a one-binding site model ywhaz-cof1-1 3 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey P23528:p.[Ser3Ala;Ser23Ala;Ser24Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:51:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser3ala,ser23ala,ser24ala' Tue Jun 30 17:07:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser3Ala;Ser23Ala;Ser24Ala]' ser phosporylation required phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 physical association physical association Overexpression of a constitutively active fragment of limk1 (302-647, kinase domain) increases the cofilin /14-3-3 association, probably by phosphorylation of cofilin. ywhaz-limk1 3 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey active kinase binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association constitutively active fragment (302-647) of LIMK1 is used association is reduced when Cos1 cells are treated with phosphatases PP1/PP2A