MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The structure of a Michaelis serpin-protease complex. The structure of a Michaelis serpin-protease complex. Nat. Struct. Biol. (1072-8368) 2001 Ye S., Cech AL., Belmares R., Bergstrom RC., Tong Y., Corey DR., Kanost MR., Goldsmith EJ. PDBe - Data obtained from the Protein Data Bank Europe in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ye S., Cech AL., Belmares R., Bergstrom RC., Tong Y., Corey DR., Kanost MR., Goldsmith EJ. PDBe - Data obtained from the Protein Data Bank Europe Nat. Struct. Biol. (1072-8368) 2001 sera_manse Alaserpin Serpin-1 protein protein manse Manduca sexta (Tobacco hawkmoth) Tobacco hornworm Tobacco hawkmoth MKIIMCIFGLAALAMAGETDLQKILRESNDQFTAQMFSEVVKANPGQNVVLSAFSVLPPLGQLALASVGESHDELLRALALPNDNVTKDVFADLNRGVRAVKGVDLKMASKIYVAKGLELNDDFAAVSRDVFGSEVQNVDFVKSVEAAGAINKWVEDQTNNRIKNLVDPDALDETTRSVLVNAIYFKGSWKDKFVKERTMDRDFHVSKDKTIKVPTMIGKKDVRYADVPELDAKMIEMSYEGDQASMIIILPNQVDGITALEQKLKDPKALSRAEERLYNTEVEIYLPKFKIETTTDLKEVLSNMNIKKLFTPGAARLENLLKTKESLYVDAAIQKAFIEVNEEGAEAAAANAFGIVPASLILYPEVHIDRPFYFELKIDGIPMFNGKVIEP 5138617BDE7EDA7A try2_rat Anionic trypsin-2 Prss2 Try2 Anionic trypsin II Pretrypsinogen II Serine protease 2 protein protein rat Rattus norvegicus (Rat) Rat MRALLFLALVGAAVAFPVDDDDKIVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN A8D3630809AEE606 prss2-sera-1 1 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction dimeric, multimeric working 84.200%, free 76.900% 2.3A