MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structure of the neurotoxic complex vipoxin at 1.4 A resolution. Structure of the neurotoxic complex vipoxin at 1.4 A resolution. Acta Crystallogr. D Biol. Crystallogr. (0907-4449) 2001 Banumathi S., Rajashankar KR., Nötzel C., Aleksiev B., Singh TP., Genov N., Betzel C. no in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Banumathi S., Rajashankar KR., Nötzel C., Aleksiev B., Singh TP., Genov N., Betzel C. no Acta Crystallogr. D Biol. Crystallogr. (0907-4449) 2001 pa2ha_vipae Acidic phospholipase A2 homolog vipoxin A chain Vipoxin non-toxic component Acidic phospholipase A2 inhibitor vipoxin A chain Vipoxin acidic component protein protein vipae Vipera ammodytes meridionalis NLFQFGDMILQKTGKEAVHSYAIYGCYCGWGGQGRAQDATDRCCFAQDCCYGRVNDCNPKTATYTYSFENGDIVCGDNDLCLRAVCECDRAAAICLGENVNTYDKNYEYYSISHCTEESEQC mint The vipoxin complex shows postsynaptic neurotoxicity. Phospholipase A2 inhibitor inhibits the phospholipase A2 of vipoxin (up to 60%) and also the phospholipases A2 from other snake venoms (15%-20%) 3759601D80ABA697 pa2b_vipae Basic phospholipase A2 vipoxin B chain Phosphatidylcholine 2-acylhydrolase Vipoxin toxic component protein protein vipae Vipera ammodytes meridionalis NLFQFAKMINGKLGAFSVWNYISYGCYCGWGGQGTPKDATDRCCFVHDCCYGRVRGCNPKLAIYSYSFKKGNIVCGKNNGCLRDICECDRVAANCFHQNKNTYNKNYKFLSSSRCRQTSEQC mint PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides The vipoxin complex show postsynaptic neurotoxicity, while the isolated phospholipase A2 is a presynaptic neurotoxin 94438F9F1285FC7D pa2ai-pa2b 1 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction In the xray complex 1jlt, P04084 is chain A and P14420 is chain B Resolution 1.400 mint