IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ An Arabidopsis SNF1-related protein kinase, AtSR1, interacts with a calcium-binding protein, AtCBL2, of which transcripts respond to light. An Arabidopsis SNF1-related protein kinase, AtSR1, interacts with a calcium-binding protein, AtCBL2, of which transcripts respond to light. Plant Cell Physiol. (0032-0781) 2001 Nozawa A., Koizumi N., Sano H. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Nozawa A., Koizumi N., Sano H. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Plant Cell Physiol. (0032-0781) 2001 An Arabidopsis SNF1-related protein kinase, AtSR1, interacts with a calcium-binding protein, AtCBL2, of which transcripts respond to light. An Arabidopsis SNF1-related protein kinase, AtSR1, interacts with a calcium-binding protein, AtCBL2, of which transcripts respond to light. Plant Cell Physiol. (0032-0781) 2001 Nozawa A., Koizumi N., Sano H. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Nozawa A., Koizumi N., Sano H. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Plant Cell Physiol. (0032-0781) 2001 cnbl2_arath Calcineurin B-like protein 2 CBL2 SCABP1 At5g55990 MDA7.3 SOS3-like calcium-binding protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSQCVDGIKHLCTSVLGCFDLDLYKQSGGLGDPELLARDTVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPIDDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLKDTVIEDIIDKTFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVEDT 342A013FC28D1445 cipke_arath CBL-interacting serine/threonine-protein kinase 14 CIPK14 At5g01820 PKS24 SnRK3.15 SR1 SOS2-like protein kinase PKS24 SNF1-related kinase 3.15 Serine/threonine-protein kinase SR1 T20L15.90 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVDSDPVEFPPENRRGQLFGKYEVGKLVGCGAFAKVYHGRSTATGQSVAIKVVSKQRLQKGGLNGNIQREIAIMHRLRHPSIVRLFEVLATKSKIFFVMEFAKGGELFAKVSKGRFCEDLSRRYFQQLISAVGYCHSRGIFHRDLKPENLLLDEKLDLKISDFGLSALTDQIRPDGLLHTLCGTPAYVAPEVLAKKGYDGAKIDIWSCGIILFVLNAGYLPFNDHNLMVMYRKIYKGEFRIPKWTSPDLRRLLTRLLDTNPQTRITIEEIIHDPWFKQGYDDRMSKFHLEDSDMKLPADETDSEMGARRMNAFDIISGSPGFNLSGLFGDARKYDRVERFVSAWTAERVVERLEEIVSAENLTVAKKETWGMKIEGQKGNFAMVVEINQLTDELVMIEVRKRQRAAASGRDLWTDTLRPFFVELVHESDQTDPEPTQVHTTS 319532FEFB7244C8 sr1-cbl2-1 2 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association CBL3 an isoform of CBL2 was also claimed to interact with SR1 in Y2H (result not shown). sr1-cbl2-2 1 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association SR1 was tagged with GST and CBL2 was His tagged. The interaction was stronger in presence of Ca2+