MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structural basis for the higher Ca(2+)-activation of the regulated actin-activated myosin ATPase observed with Dictyostelium/Tetrahymena actin chimeras. Structural basis for the higher Ca(2+)-activation of the regulated actin-activated myosin ATPase observed with Dictyostelium/Tetrahymena actin chimeras. J. Mol. Biol. (0022-2836) 2000 Matsuura Y., Stewart M., Kawamoto M., Kamiya N., Saeki K., Yasunaga T., Wakabayashi T. no in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Matsuura Y., Stewart M., Kawamoto M., Kamiya N., Saeki K., Yasunaga T., Wakabayashi T. no J. Mol. Biol. (0022-2836) 2000 act1_dicdi Major actin act1 act2 act4 act5 act6 act7 act8 act9 act11 Actin A1 Actin III Actin-3a Actin-16 Actin M6 Actin-19 Actin-20 Actin-21 DDB_G0289553 DDB_G0274133 DDB_G0289005 DDB_G0289663 DDB_G0274135 DDB_G0280545 DDB_G0269234 DDB_G0274601 DDB_G0288879 DDB_G0274129 DDB_G0274599 DDB_G0274137 DDB_G0272520 DDB_G0272248 DDB_G0274727 DDB_G0274285 DDB_G0274561 act12 act13 act14 act15 act16 act19 act20 act21 act1a act2-1 actA8 actB1 actA1 actM6 Actin-1 Actin-2 Actin-2-sub 1 Actin-4 Actin-5 Actin-6 Actin-7 Actin-8 Actin A8 Actin-IEL1 Actin-9 Actin-11 Actin-12 Actin A12 Actin-13 Actin-14 Actin-15 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MDGEDVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYMMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEAEMQTAASSSALEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF DIP protein P07830 original sequence version: 75 mint Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. Multiple isoforms are involved in various cellular functions such as cytoskeleton structure, cell mobility, chromosome movement and muscle contraction 3610737F3B525123 gels_human Gelsolin GSN Actin-depolymerizing factor Brevin AGEL protein protein human Homo sapiens Human MAPHRPAPALLCALSLALCALSLPVRAATASRGASQAGAPQGRVPEARPNSMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA DIP protein P06396 original sequence version: 89 DIP protein P06396 original sequence version: 176 DIP protein P06396-1 original sequence version: 115 DIP protein P06396 original sequence version: 138 DIP protein P06396-1 original sequence version: 138 DIP protein P06396 original sequence version: 184 DIP protein P06396 original sequence version: 137 8CEBC52257A160F7 act1-gsn 1 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction In the xray complex 1c0g, P07830 is chain A and P06396 is chain S Resolution 2.000 mint