MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structural basis of chaperone function and pilus biogenesis. Structural basis of chaperone function and pilus biogenesis. Science (0036-8075) 1999 Sauer FG., Fütterer K., Pinkner JS., Dodson KW., Hultgren SJ., Waksman G. no in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sauer FG., Fütterer K., Pinkner JS., Dodson KW., Hultgren SJ., Waksman G. no Science (0036-8075) 1999 papd_ecolx Chaperone protein PapD papD protein protein ecolx Escherichia coli MIRKKILMAAIPLFVISGADAAVSLDRTRAVFDGSEKSMTLDISNDNKQLPYLAQAWIENENQEKIITGPVIATPPVQRLEPGAKSMVRLSTTPDISKLPQDRESLFYFNLREIPPRSEKANVLQIALQTKIKLFYRPAAIKTRPNEVWQDQLILNKVSGGYRIENPTPYYVTVIGLGGSEKQAEEGEFETVMLSPRSEQTVKSANYNTPYLSYINDYGGRPVLSFICNGSRCSVKKEK DIP protein P15319 original sequence version: 98 DIP protein P15319 original sequence version: 70 D8AAEA2B346D7268 papk_ecol6 Fimbrial adapter PapK papK papK2 c3586 c5182 protein protein ecol6 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) MIKSTGALLLFAALSAGQAIASDVAFRGNLLDRPCHVSGDSLNKHVVFKTRASRDFWYPPGRSPTESFVIRLENCHATAVGKIVTLTFKGTEEAALPGHLKVTGVNAGRLGIALLDTDGSSLLKPGTSHNKGQGEKVTGNSLELPFGAYVVATPEALRTKSVVPGDYEATATFELTYR mint Adapter that links the pilus rod to the base of the tip fibrillum. Regulates the length of the tip fibrillum and joins it to the pilus rod. Pili are polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, and enable bacteria to colonize the epithelium of specific host organs DABF3054B87CA8CB papd-papk 1 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction In the xray complex 1pdk, P15319 is chain A and P42190 is chain B Resolution 2.400 mint