IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Negative regulation of male development in Caenorhabditis elegans by a protein-protein interaction between TRA-2A and FEM-3. Negative regulation of male development in Caenorhabditis elegans by a protein-protein interaction between TRA-2A and FEM-3. Genes Dev. (0890-9369) 1999 Mehra A., Gaudet J., Heck L., Kuwabara PE., Spence AM. Fig 3 andrew.spence@utoronto.ca yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mehra A., Gaudet J., Heck L., Kuwabara PE., Spence AM. Fig 3 andrew.spence@utoronto.ca Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Genes Dev. (0890-9369) 1999 Negative regulation of male development in Caenorhabditis elegans by a protein-protein interaction between TRA-2A and FEM-3. Negative regulation of male development in Caenorhabditis elegans by a protein-protein interaction between TRA-2A and FEM-3. Genes Dev. (0890-9369) 1999 Mehra A., Gaudet J., Heck L., Kuwabara PE., Spence AM. Fig 3 andrew.spence@utoronto.ca in vitro In vitro coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Mehra A., Gaudet J., Heck L., Kuwabara PE., Spence AM. Fig 3 andrew.spence@utoronto.ca Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Genes Dev. (0890-9369) 1999 fem3_caeel Sex-determination protein fem-3 Feminization of XX and XO animals protein 3 Ce-FEM-3 C01F6.4 fem-3 protein protein caeel Caenorhabditis elegans MEVDPGSDDVEADRETRAQKLKLKRNVKFRAQMRRFDEYCGVTNLTVDDLNWPLISGIPLQRQRLTGATYYDDSLLDQNPWDEFSIDRFLEITSIQLITAGAGYERNDEITRFVFQRTMKTIVTYCNFMYDLARRNGKVQITRFELQDLIHRDEFRFYMYFRQFLPNPDPNCTAFSNHYTSLLHTLYFNIPGMPQFWNNSQMYNYAATRGQRLVQNIAAFYPPEYFWNEDESKYHTTFVVPRGTEFSKFYARRFHEALGMPPLENEIITVLDWLAKLCILEIVYHTTIWCDITGFGGLPRIEHYRLAMENVEDIIFDLAIDDFSISRLQLQISPFEISRYSPLDVSGYYETIKRKKDIEEYQNRFYEVHYSDDVRIMNVYATDCSRKR 5366B23BBCF0CA28 tra2_caeel Sex-determining transformer protein 2 tra-2 C15F1.3 Ce-Tra-2 protein protein caeel Caenorhabditis elegans MKLKYNKLLVSVVIVTFVTFGLLLAECFGKSIDYQEKSIFPSFVSQGFFETRTNNEEYIIEKIAQTQENGVDMRSTLHFTQHGYLLNNISNLKIKFRQKTYTLNDVCFKPHITIFQQSSSSDQNEYPHYIQRLLLEMQRLSPCLIVTPLNCFYDIYRIHGEISNWNKNTDFLNRRLRNSYIEAIGENDERPYVKSNYGPSLIKSWADHMFDLPSKSFTNSTKDALFQKIKLWLLSIEPRQKTCAASIHSCDTPLDSEHYFNICTDMQSVDNFAEKKTKFKLEDVDEEFAMNLDCVDDQEQFIEWMQELEIRKMYSHVTEKPDYPNVVNQTCDKIFHDLNSTGIEFFDGSRSFSSTKSQFDTMQTEIVLLTPEMLLSAMQHSDFVNGFESIWTIEKAEELIHEFRLALKEETEKFKENRMSKMIRVTSRVLDNTVTTKLQSFSEKQTIHFVVNVHSLIVILFTIFVWSGAPLRSAFMFFVRDALTCLLFCFVCSTDGVIVLDTELIKYIIVLTLANLYFTTRSSFCTERLSRCIQREKRFPINSNFASLITVDTMTDSRQIQYFLSTVTKYQAAQDSYSNELFERFPKNWGCTSILIFPIVFVYWYFIDSNFDKICVSVLPSFCLAAGEELFAKNMFWKEREAMQAKQRLENEEQAESITGSSLEKLFAGNKPVSNTDKANIVKKSSIIRNQKPCLQDLSPGTYDVSNFMKYPHQASRIFREKIIGLYLRILKLRTLGVILCIPAILLIVISIGLLFIPVKRETLHTDSKQDDIFIEFEIFNFSTNWKIVNQNLKQFSEDIESIGTLYTISNWQKSFERFEQETNKNASAEWNILFKWINDEPINSAVTLFSEKSSGNQTIANPFKFRLRYGFDAKNETTVIEIVQKIDELLSKCSKNLSPKAVGVLYEHYHRIAVVWNLFAFNQLTTAGIFIILLSIITFIFAITPTIKATFLFSLLVVGTQIEVAALVHLFSLDHHQIYTNLALFAGFLAAWDPFCALLRYRRRILYKSETRRTPELASKRRVLLPIVATADIAQFFVLLITAFSILAIICSIVPELNIFFVPTVILIVIQIVAVFNSIIVSIATKQMFESEVRHYLHRDLRGSTTAVRVYNLVQKQRLASSLDEPQVELDEFSIKRSSPPCRYYAPPPKYSCKKRSRSSDEDEDSDPNQPGPSNRRSPKTGNKRVRGNGDNTELYIPNRYELIVSGKSVGGNTSAAWNGPGSTLEQNMNALEECFELGVDEYDFDEHDGDEGCELVQDMLDRERNLMNKRSTAQRRESRNIEKMKKSQENLDKEKSEEKISESKKNQDDSIESPNLPGTPANLPVDEPLPPVGRLYIVEHVLPEEYRRDPLTEPPSMEDCIRAHSDPNLPPHPRADQYPASFTRPMVEYCEDIYWTHRTGQLPPGLQVPRRPYDYYHITERTPPPEDLNWVPPAESPPIPIPQQAFDLLEERRRNHREQQDEAREGDLSDPEV F8C6456B3D3654BE fem3-tra2-2 2 4 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 3 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag monoclonal western monoclonal antibody western blot n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro physical association physical association Shows that the c-terminal domain of tra-2 can associate with fem-3. revisit when protein editor is in place fem3-tra2-1 1 3 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-640566]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 389-389, sequence length 388 [EBI-640566]310-389 4 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association A 141 AA region of tra-2 was able to interact with 1-343AA of fem-3. Deletion of AA 1-69 or 309-388 in fem-3 inhibited binding to tra-2. revisit when protein editor in place