MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it A novel adaptor protein orchestrates receptor patterning and cytoskeletal polarity in T-cell contacts. A novel adaptor protein orchestrates receptor patterning and cytoskeletal polarity in T-cell contacts. Cell (0092-8674) 1998 Dustin ML., Olszowy MW., Holdorf AD., Li J., Bromley S., Desai N., Widder P., Rosenberger F., van der Merwe PA., Allen PM., Shaw AS. no in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Dustin ML., Olszowy MW., Holdorf AD., Li J., Bromley S., Desai N., Widder P., Rosenberger F., van der Merwe PA., Allen PM., Shaw AS. no Cell (0092-8674) 1998 A novel adaptor protein orchestrates receptor patterning and cytoskeletal polarity in T-cell contacts. A novel adaptor protein orchestrates receptor patterning and cytoskeletal polarity in T-cell contacts. Cell (0092-8674) 1998 Dustin ML., Olszowy MW., Holdorf AD., Li J., Bromley S., Desai N., Widder P., Rosenberger F., van der Merwe PA., Allen PM., Shaw AS. no human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Dustin ML., Olszowy MW., Holdorf AD., Li J., Bromley S., Desai N., Widder P., Rosenberger F., van der Merwe PA., Allen PM., Shaw AS. no Cell (0092-8674) 1998 A novel adaptor protein orchestrates receptor patterning and cytoskeletal polarity in T-cell contacts. A novel adaptor protein orchestrates receptor patterning and cytoskeletal polarity in T-cell contacts. Cell (0092-8674) 1998 Dustin ML., Olszowy MW., Holdorf AD., Li J., Bromley S., Desai N., Widder P., Rosenberger F., van der Merwe PA., Allen PM., Shaw AS. no in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Dustin ML., Olszowy MW., Holdorf AD., Li J., Bromley S., Desai N., Widder P., Rosenberger F., van der Merwe PA., Allen PM., Shaw AS. no Cell (0092-8674) 1998 cd2ap_human CD2-associated protein CD2AP Cas ligand with multiple SH3 domains Adapter protein CMS protein protein human Homo sapiens Human MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRETEFKDDSLPIKRERHGNVASLVQRISTYGLPAGGIQPHPQTKNIKKKTKKRQCKVLFEYIPQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSNFVKELEVTDDGETHEAQDDSETVLAGPTSPIPSLGNVSETASGSVTQPKKIRGIGFGDIFKEGSVKLRTRTSSSETEEKKPEKPLILQSLGPKTQSVEITKTDTEGKIKAKEYCRTLFAYEGTNEDELTFKEGEIIHLISKETGEAGWWRGELNGKEGVFPDNFAVQINELDKDFPKPKKPPPPAKAPAPKPELIAAEKKYFSLKPEEKDEKSTLEQKPSKPAAPQVPPKKPTPPTKASNLLRSSGTVYPKRPEKPVPPPPPIAKINGEVSSISSKFETEPVSKLKLDSEQLPLRPKSVDFDSLTVRTSKETDVVNFDDIASSENLLHLTANRPKMPGRRLPGRFNGGHSPTHSPEKILKLPKEEDSANLKPSELKKDTCYSPKPSVYLSTPSSASKANTTAFLTPLEIKAKVETDDVKKNSLDELRAQIIELLCIVEALKKDHGKELEKLRKDLEEEKTMRSNLEMEIEKLKKAVLSS DIP protein Q9Y5K6 original sequence version: 92 DIP protein Q9Y5K6 original sequence version: 94 DIP protein Q9Y5K6 original sequence version: 98 7576509C7ED5B343 cd2_human T-cell surface antigen CD2 CD2 SRBC Erythrocyte receptor LFA-2 LFA-3 receptor Rosette receptor T-cell surface antigen T11/Leu-5 protein protein human Homo sapiens Human MSFPCKFVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQERVSKPKISWTCINTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSLSAKFKCTAGNKVSKESSVEPVSCPEKGLDIYLIIGICGGGSLLMVFVALLVFYITKRKKQRSRRNDEELETRAHRVATEERGRKPHQIPASTPQNPATSQHPPPPPGHRSQAPSHRPPPPGHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSSN A03D853C3B618917 cd2b2_human CD2 antigen cytoplasmic tail-binding protein 2 CD2BP2 KIAA1178 U5 snRNP 52K protein protein protein human Homo sapiens Human MPKRKVTFQGVGDEEDEDEIIVPKKKLVDPVAGSGGPGSRFKGKHSLDSDEEEDDDDGGSSKYDILASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNYFLNRDAQIRDSWLDNIDWVKIRERPPGQRQASDSEEEDSLGQTSMSAQALLEGLLELLLPRETVAGALRRLGARGGGKGRKGPGQPSSPQRLDRLSGLADQMVARGNLGVYQETRERLAMRLKGLGCQTLGPHNPTPPPSLDMFAEELAEEELETPTPTQRGEAESRGDGLVDVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT 8E9A7EE0C40474D5 cd2-cd2ap-4 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1539224: original sequence: 1-53 : MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDN Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain PROLINE RICH range MINT-1539215: original sequence: 317-337 : GTQVHQQKGPPLPRPRVQPK Stoichiometry: 1.0 direct interaction direct interaction F6 sh3 homomint mint cd2-cd2bp2-7 3 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1539240: original sequence: 326-333 : SGTQVHQQKGPPLPRPRVQPKPPHGAA Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1539246: original sequence: 2-57 : PKRKVTFQGVGDEEDEDEIIVPKKKLVDPVAGSGGPGSRFKGKHSLDSDEEEDDD Stoichiometry: 1.0 direct interaction direct interaction homomint mint cd2-cd2ap-5 2 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-1539266: original sequence: 1-53 : MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDN tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain PROLINE RICH range MINT-1539257: original sequence: 321-351 : HQQKGPPLPRPRVQPKPPHGAAENSLSPSS tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F5B sh3 homomint mint