MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Serine phosphorylation of death agonist BAD in response to survival factor results in binding to 14-3-3 not BCL-X(L) Serine phosphorylation of death agonist BAD in response to survival factor results in binding to 14-3-3 not BCL-X(L) Cell (0092-8674) 1996 Zha J., Harada H., Yang E., Jockel J., Korsmeyer SJ. no partial coverage rapid curation in vitro In vitro experimental interac experimental interaction detection experimental interac predetermined predetermined participant predetermined Zha J., Harada H., Yang E., Jockel J., Korsmeyer SJ. no Cell (0092-8674) 1996 partial coverage rapid curation Serine phosphorylation of death agonist BAD in response to survival factor results in binding to 14-3-3 not BCL-X(L) Serine phosphorylation of death agonist BAD in response to survival factor results in binding to 14-3-3 not BCL-X(L) Cell (0092-8674) 1996 Zha J., Harada H., Yang E., Jockel J., Korsmeyer SJ. no partial coverage rapid curation unknown Unknown coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Zha J., Harada H., Yang E., Jockel J., Korsmeyer SJ. no Cell (0092-8674) 1996 partial coverage rapid curation Serine phosphorylation of death agonist BAD in response to survival factor results in binding to 14-3-3 not BCL-X(L) Serine phosphorylation of death agonist BAD in response to survival factor results in binding to 14-3-3 not BCL-X(L) Cell (0092-8674) 1996 Zha J., Harada H., Yang E., Jockel J., Korsmeyer SJ. no partial coverage rapid curation in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Zha J., Harada H., Yang E., Jockel J., Korsmeyer SJ. no Cell (0092-8674) 1996 partial coverage rapid curation 1433t_mouse 14-3-3 protein theta Ywhaq 14-3-3 protein tau protein protein mouse Mus musculus Mouse MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN E30471260E8B366E bad_mouse Bcl2-associated agonist of cell death Bad Bbc6 Bcl-2-binding component 6 Bcl-xL/Bcl-2-associated death promoter Bcl2 antagonist of cell death protein protein mouse Mus musculus Mouse MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASATDRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ DIP protein Q61337 original sequence version: 60 6C2BA910205053F7 ywhaq-bad 3 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-1520463: original sequence: 112-112 : GAMETRSRHSSYPAGTEEDE phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-1520461: original sequence: 136-136 : ELSPFRGRSRSAPPNLWAAQ Stoichiometry: 1.0 physical association physical association - screening in expression cloning with BAD-GST with Heart Muscle Kinase domain p32 labeled screening an embryonic mouse library , 14-3-3 TAUrn- CoIP with anti BAD, western with anti 14-3-3. In FL5.12, overexpression of BAD and HA-14-3-3rn- Alanine scanning in CoIP overexpressing BAD and HA-14-3-3: each ser can singularly bind 14-3-3rn- When ser mutated bad is expressed, cell die because they interact BAD-Bcl-XLrn domino mint bad-ywhaq-2 1 4 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 5 unspecified role unspecified role unspecified role unspecified role purified purified phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-1520478: original sequence: 136-136 : ELSPFRGRSRSAPPNLWAAQ phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-1520480: original sequence: 112-112 : GAMETRSRHSSYPAGTEEDE Stoichiometry: 1.0 association association - screening in expression cloning with BAD-GST with Heart Muscle Kinase domain p32 labeled screening an embryonic mouse library , 14-3-3 TAUrn- CoIP with anti BAD, western with anti 14-3-3. In FL5.12, overexpression of BAD and HA-14-3-3rn- Alanine scanning in CoIP overexpressing BAD and HA-14-3-3: each ser can singularly bind 14-3-3rn- When ser mutated bad is expressed, cell die because they interact BAD-Bcl-XLrn domino mint bad-ywhaq-3 2 1433T_MOUSE 4 unspecified role unspecified role unspecified role unspecified role BAD_MOUSE 5 unspecified role unspecified role unspecified role unspecified role association association domino mint bad-ywhaq-4 2 1433T_MOUSE 4 unspecified role unspecified role unspecified role unspecified role BAD_MOUSE 5 unspecified role unspecified role unspecified role unspecified role association association domino mint