UniProt UniProt http://www.uniprot.org Interleukin-2 receptor gamma chain: a functional component of the interleukin-7 receptor. Interleukin-2 receptor gamma chain: a functional component of the interleukin-7 receptor. Science (0036-8075) 1993 Noguchi M., Nakamura Y., Russell SM., Ziegler SF., Tsang M., Cao X., Leonard WJ. IL7 were crosslinked to PHA-activated peripheral blood leukocytes which were affinity labelled with radio-labelled IL7. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Noguchi M., Nakamura Y., Russell SM., Ziegler SF., Tsang M., Cao X., Leonard WJ. IL7 were crosslinked to PHA-activated peripheral blood leukocytes which were affinity labelled with radio-labelled IL7. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Science (0036-8075) 1993 Interleukin-2 receptor gamma chain: a functional component of the interleukin-7 receptor. Interleukin-2 receptor gamma chain: a functional component of the interleukin-7 receptor. Science (0036-8075) 1993 Noguchi M., Nakamura Y., Russell SM., Ziegler SF., Tsang M., Cao X., Leonard WJ. IL7 were crosslinked to PHA-activated peripheral blood leukocytes which were affinity labelled with radio-labelled IL7. in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Noguchi M., Nakamura Y., Russell SM., Ziegler SF., Tsang M., Cao X., Leonard WJ. IL7 were crosslinked to PHA-activated peripheral blood leukocytes which were affinity labelled with radio-labelled IL7. IL7 were crosslinked to PHA-activated peripheral blood leukocytes which were affinity labelled with radio-labelled IL7. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Science (0036-8075) 1993 Interleukin-2 receptor gamma chain: a functional component of the interleukin-7 receptor. Interleukin-2 receptor gamma chain: a functional component of the interleukin-7 receptor. Science (0036-8075) 1993 Noguchi M., Nakamura Y., Russell SM., Ziegler SF., Tsang M., Cao X., Leonard WJ. IL7 were crosslinked to PHA-activated peripheral blood leukocytes which were affinity labelled with radio-labelled IL7. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Noguchi M., Nakamura Y., Russell SM., Ziegler SF., Tsang M., Cao X., Leonard WJ. IL7 was crosslinked to PHA-activated peripheral blood leukocytes which were affinity labelled with radio-labelled IL7. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Science (0036-8075) 1993 il7_human Interleukin-7 IL7 protein protein human Homo sapiens Human MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH DIP protein P13232 original sequence version: 103 8FC5243F9169617F il2rg_human Cytokine receptor common subunit gamma IL2RG p64 gammaC Interleukin-2 receptor subunit gamma protein protein human Homo sapiens Human MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET 3B6215246D610215 il7ra_human Interleukin-7 receptor subunit alpha IL7R CDw127 protein protein human Homo sapiens Human MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDPILLTISILSFFSVALLVILACVLWKKRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPESFGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFSLQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ EF50BF2615EEF50C il7-il7r-1 3 4 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 6 unspecified role unspecified role bait bait chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association Proteins were cross-linked before cell-lysis. Il7 was affinity labelled. il7-il2rg-2 3 4 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 5 unspecified role unspecified role bait bait chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association Interaction is dependent upon presence of IL7R. Il7 was affinity labelled. Proteins were cross-linked before cell-lysis. il7-il7r-2 1 4 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-periph_blood_leukoc Homo sapiens peripheral blood leukocytes peripheral_blood_leukocyte Peripheral blood leukocytes [Peripheral blood leucocytes] 6 unspecified role unspecified role bait bait human-periph_blood_leukoc Homo sapiens peripheral blood leukocytes peripheral_blood_leukocyte Peripheral blood leukocytes [Peripheral blood leucocytes] physical association physical association CoIP was weak. Peripheral blood lymphocytes have been used. il7-il2rg-1 1 4 unspecified role unspecified role bait bait human-periph_blood_leukoc Homo sapiens peripheral blood leukocytes peripheral_blood_leukocyte Peripheral blood leukocytes [Peripheral blood leucocytes] 5 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-periph_blood_leukoc Homo sapiens peripheral blood leukocytes peripheral_blood_leukocyte Peripheral blood leukocytes [Peripheral blood leucocytes] physical association physical association Peripheral blood leukocytes have been used. CoIp was strong. il7-il7r-3 2 6 unspecified role unspecified role neutral component neutral component chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 4 unspecified role unspecified role neutral component neutral component radiolabel tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association