UniProt UniProt http://www.uniprot.org Sharing of the interleukin-2 (IL-2) receptor gamma chain between receptors for IL-2 and IL-4. Sharing of the interleukin-2 (IL-2) receptor gamma chain between receptors for IL-2 and IL-4. Science (0036-8075) 1993 Kondo M., Takeshita T., Ishii N., Nakamura M., Watanabe S., Arai K., Sugamura K. Proteins were crosslinked before cell lysis. in vitro In vitro bifunctional agent crosslink protein cross-linking with a bifunctional reagent Label transfer techniques Photoaffinity labelling Label transfer techniques Photoaffinity labelling bifunctional agent crosslink predetermined predetermined participant predetermined Kondo M., Takeshita T., Ishii N., Nakamura M., Watanabe S., Arai K., Sugamura K. Proteins were crosslinked before cell lysis. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Science (0036-8075) 1993 Sharing of the interleukin-2 (IL-2) receptor gamma chain between receptors for IL-2 and IL-4. Sharing of the interleukin-2 (IL-2) receptor gamma chain between receptors for IL-2 and IL-4. Science (0036-8075) 1993 Kondo M., Takeshita T., Ishii N., Nakamura M., Watanabe S., Arai K., Sugamura K. Proteins were crosslinked before cell lysis. in vitro In vitro bifunctional agent crosslink protein cross-linking with a bifunctional reagent Label transfer techniques Photoaffinity labelling Label transfer techniques Photoaffinity labelling bifunctional agent crosslink predetermined predetermined participant predetermined Kondo M., Takeshita T., Ishii N., Nakamura M., Watanabe S., Arai K., Sugamura K. Proteins were crosslinked before cell lysis. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Science (0036-8075) 1993 il2_mouse Interleukin-2 Il2 Il-2 T-cell growth factor protein protein mouse Mus musculus Mouse MYSMQLASCVTLTLVLLVNSAPTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKLPRMLTFKFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENFISNIRVTVVKLKGSDNTFECQFDDESATVVDFLRRWIAFCQSIISTSPQ B3B17644F6EF83CA il2rg_mouse Cytokine receptor common subunit gamma Il2rg p64 gammaC Interleukin-2 receptor subunit gamma protein protein mouse Mus musculus Mouse MLKLLLSPRSFLVLQLLLLRAGWSSKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEVQCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIKERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSKWSQPVHWGSHTVEENPSLFALEAVLIPVGTMGLIITLIFVYCWLERMPPIPPIKNLEDLVTEYQGNFSAWSGVSKGLTESLQPDYSERFCHVSEIPPKGGALGEGPGGSPCSLHSPYWPPPCYSLKPEA CB2D5AB459077AC7 il4_mouse Interleukin-4 Il4 Il-4 B-cell stimulatory factor 1 Lymphocyte stimulatory factor 1 IGG1 induction factor B-cell growth factor 1 B-cell IgG differentiation factor protein protein mouse Mus musculus Mouse MGLNPQLVVILLFFLECTRSHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS E43CE16195DE051F il2rg-il2-1 1 3 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse-ctll_2 Mus musculus CTLL-2 C57b1/6 T cell lymphoblasts ctll_2 CTLL-2 mouse C57b1/6 T cell lymphoblasts 4 unspecified role unspecified role bait bait mouse-ctll_2 Mus musculus CTLL-2 C57b1/6 T cell lymphoblasts ctll_2 CTLL-2 mouse C57b1/6 T cell lymphoblasts direct interaction direct interaction Il2 was affinity labelled. Proteins were crosslinked before cell lysis. il2rg-il4-1 2 4 unspecified role unspecified role bait bait mouse-ctll_2 Mus musculus CTLL-2 C57b1/6 T cell lymphoblasts ctll_2 CTLL-2 mouse C57b1/6 T cell lymphoblasts 5 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse-ctll_2 Mus musculus CTLL-2 C57b1/6 T cell lymphoblasts ctll_2 CTLL-2 mouse C57b1/6 T cell lymphoblasts direct interaction direct interaction Il4 was affinity labelled. Proteins were cross-linked before cell lysis.