IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Slit stimulation recruits Dock and Pak to the roundabout receptor and increases Rac activity to regulate axon repulsion at the CNS midline. Slit stimulation recruits Dock and Pak to the roundabout receptor and increases Rac activity to regulate axon repulsion at the CNS midline. Neuron (0896-6273) 2003 Fan X., Labrador JP., Hing H., Bashaw GJ. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Fan X., Labrador JP., Hing H., Bashaw GJ. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Neuron (0896-6273) 2003 Slit stimulation recruits Dock and Pak to the roundabout receptor and increases Rac activity to regulate axon repulsion at the CNS midline. Slit stimulation recruits Dock and Pak to the roundabout receptor and increases Rac activity to regulate axon repulsion at the CNS midline. Neuron (0896-6273) 2003 Fan X., Labrador JP., Hing H., Bashaw GJ. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid western blot western blot Immuno blot Immuno blot Fan X., Labrador JP., Hing H., Bashaw GJ. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Neuron (0896-6273) 2003 Slit stimulation recruits Dock and Pak to the roundabout receptor and increases Rac activity to regulate axon repulsion at the CNS midline. Slit stimulation recruits Dock and Pak to the roundabout receptor and increases Rac activity to regulate axon repulsion at the CNS midline. Neuron (0896-6273) 2003 Fan X., Labrador JP., Hing H., Bashaw GJ. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Fan X., Labrador JP., Hing H., Bashaw GJ. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Neuron (0896-6273) 2003 Slit stimulation recruits Dock and Pak to the roundabout receptor and increases Rac activity to regulate axon repulsion at the CNS midline. Slit stimulation recruits Dock and Pak to the roundabout receptor and increases Rac activity to regulate axon repulsion at the CNS midline. Neuron (0896-6273) 2003 Fan X., Labrador JP., Hing H., Bashaw GJ. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Fan X., Labrador JP., Hing H., Bashaw GJ. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Neuron (0896-6273) 2003 q7jws8_drome Mtl 5588 Dmel\CG5588 MTL Mig2-like Mt1 Rac Rac GTPase Rac-like dMig-2 mtl Dmel_CG5588 CG5588 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSTGRPIKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWDTAGQEDYDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKIDLREDRETLSGLAEQGLTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVLRPEPLKRRQRKCLIM 6A144484302B0C58 rac2_drome Ras-related protein Rac2 Rac2 RacB CG8556 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSVPIILVGTKLDLRDDKQTIEKLKDKKLTPITYPQGLAMAKEIAAVKYLECSALTQKGLKTVFDEAIRSVLCPVVRGPKRHKCALL DIP protein P48554 original sequence version: 93 06AE11CC18019982 o44924_drome robo1 robo CG13521 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MHPMHPENHAIARSTSTTNNPSRSRSSRMWLLPAWLLLVLVASNGLPAVRGQYQSPRIIEHPTDLVVKKNEPATLNCKVEGKPEPTIEWFKDGEPVSTNEKKSHRVQFKDGALFFYRTMQGKKEQDGGEYWCVAKNRVGQAVSRHASLQIAVLRDDFRVEPKDTRVAKGETALLECGPPKGIPEPTLIWIKDGVPLDDLKAMSFGASSRVRIVDGGNLLISNVEPIDEGNYKCIAQNLVGTRESSYAKLIVQVKPYFMKEPKDQVMLYGQTATFHCSVGGDPPPKVLWKKEEGNIPVSRARILHDEKSLEISNITPTDEGTYVCEAHNNVGQISARASLIVHAPPNFTKRPSNKKVGLNGVVQLPCMASGNPPPSVFWTKEGVSTLMFPNSSHGRQYVAADGTLQITDVRQEDEGYYVCSAFSVVDSSTVRVFLQVSSVDERPPPIIQIGPANQTLPKGSVATLPCRATGNPSPRIKWFHDGHAVQAGNRYSIIQGSSLRVDDLQLSDSGTYTCTASGERGETSWAATLTVEKPGSTSLHRAADPSTYPAPPGTPKVLNVSRTSISLRWAKSQEKPGAVGPIIGYTVEYFSPDLQTGWIVAAHRVGDTQVTISGLTPGTSYVFLVRAENTQGISVPSGLSNVIKTIEADFDAASANDLSAARTLLTGKSVELIDASAINASAVRLEWMLHVSADEKYVEGLRIHYKDASVPSAQYHSITVMDASAESFVVGNLKKYTKYEFFLTPFFETIEGQPSNSKTALTYEDVPSAPPDNIQIGMYNQTAGWVRWTPPPSQHHNGNLYGYKIEVSAGNTMKVLANMTLNATTTSVLLNNLTTGAVYSVRLNSFTKAGDGPYSKPISLFMDPTHHVHPPRAHPSGTHDGRHEGQDLTYHNNGNIPPGDINPTTHKKTTDYLSGPWLMVLVCIVLLVLVISAAISMVYFKRKHQMTKELGHLSVVSDNEITALNINSKESLWIDHHRGWRTADTDKDSGLSESKLLSHVNSSQSNYNNSDGGTDYAEVDTRNLTTFYNCRKSPDNPTPYATTMIIGTSSSETCTKTTSISADKDSGTHSPYSDAFAGQVPAVPVVKSNYLQYPVEPINWSEFLPPPPEHPPPSSTYGYAQGSPESSRKSSKSAGSGISTNQSILNASIHSSSSGGFSAWGVSPQYAVACPPENVYSNPLSAVAGGTQNRYQITPTNQHPPQLPAYFATTGPGGAVPPNHLPFATQRHAASEYQAGLNAARCAQSRACNSCDALATPSPMQPPPPVPVPEGWYQPVHPNSHPMHPTSSNHQIYQCSSECSDHSRSSQSHKRQLQLEEHGSSAKQRGGHHRRRAPVVQPCMESENENMLAEYEQRQYTSDCCNSSREGDTCSCSEGSCLYAEAGEPAPRQMTAKNT B820E234A5218983 pak_drome Serine/threonine-protein kinase Pak Pak DPAK Dpak1 CG10295 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSSEEDKPPAPPVRLTSNRGGNERSGGGVGVGGGGLGGGGMGDVPPDMRPLPKEPDDSDRKKKTLKSKIKGSKPSHTDSKPNISYPTNFEHTVHVGFDAVTGEFTGMPEAWARLLMNSNISKQEQKKNPQAVLDVLKWFDNTTKQRPSSKYMTNAITTHSGSSLSRVSSSSPSSTPTDSELHGSNSGGNLIGVQLGSMTLGPNANNVAVAGQILGNHYQQQQQHLLQQQQPLLHQNHNQHHMGISQSHSYNFVGHTVSSSTSQHSSANEDDMLGPQHPQQQPPPPPVASRPERTKSIYTRPIEDLQPAIIPMPVAPATTPATPLQNHRTPGGISAPAASPMMHNNATTTLDKNKNNANLYTPEPTVAQVSAGGPSSQVAGNQIAVPQAAVAPAATPNTRAANAKKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFLKLARPLASLTPLIMAAKEATKGN A5A095564A9A2453 q24218_drome dock CG3727 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAGNMKHGKSQDDVCYVVAKYDYAAQGAQELDLRKNERYLLLDDSKHWWRVQNSRNQSGYVPSNYVKKEKPSLFDSIKKKVKKGSGSKTLPNCSPSRQVESPTMSRRLPPDPAEAIGTAVVKYNYQAQQPDELSLTKGTRILILEKSNDGWWRGQSGNSVGWFPSNYTTEDCDNDGEIHTYAMAENVLDIVVALYSFTSNNDQELSFEKGDRLEIVDRPASDPDWYKARNNQGQVGLVPRNYLQELNDYLATPYRNTSASAGNGNGGGSNGGAGGGGGNDSMERRNEGNKPAAQSSGQPIERPNLAGKSWYYGAITRSQCDTVLNGHGHDGDFLIRDSETNMGDYSVSLKAPGRNKHFRVHVEQNMYCIGQRKFHSLDQLVDHYQRAPIYTNKQGEKLYLVRSLPKANGT 6B0F0027A4C16CDF rac1_drome Ras-related protein Rac1 Rac1 RacA CG2248 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQPKSKRKCALL F910B54BDBD8AFA3 robo-dock-1 2 9 unspecified role unspecified role prey prey lexa tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain b42 tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association cytoplasmic domains of Robo1 (AA 939-1345) was fused to B42. Dock was fused to LexA. revisit when protein editor in place. robo-dock-2 1 7 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey physical association physical association This interaction is stimulated by treatment of cells by Slit. robo-robo-1 1 7 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey physical association physical association myc tagged Robo was used to pull down wild type Robo. dock-pak-1 2 9 unspecified role unspecified role bait bait b42 tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey lexa tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Dock was expressed as a P42 fusion product and Pak was expressed as a Lex fusion product. pak-rac1-1 2 8 unspecified role unspecified role bait bait b42 tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey lexa tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Pak was a B42 fusion protein while Rac1 was a Lex fusion protein. pak-rac2-1 2 8 unspecified role unspecified role bait bait b42 tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey lexa tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Pak was expressed as a B42 fusion while Rac2 was expressed as a Lex fusion. robo-dock-5 4 8 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 7 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 9 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association Robo was his tagged. This activity is Slit dependent. robo-rac1-1 3 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 7 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. association association myc tagged robo, HA tagged Rac1 and GST tagged Pzk (AA 77-151) were used in the experiment. The coprecipitation occured only in the presence of Slit. revisit when protein editor in place. robo-rac2-1 3 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 7 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. association association Myc tagged Robo and HA tagged Rac2 were pulled down by GST tagged Pak (AA77-151) in the presence of Slit. revisit when protein editor in place. robo-mtl-1 3 7 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. association association myc tagged Robo and HA tagged Mtl were pulled down by GST tagged Pak (AA 77-151) in the presence of Slit. revisit when protein editor in place. robo-dock-3 2 7 unspecified role unspecified role bait bait cytoplasmic region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain b42 tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey lexa tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association cytoplasmic domains of Robo1 (AA 1084-1395) was fused to B42. Dock was fused to LexA. revisit when protein editor in place robo-dock-4 2 9 unspecified role unspecified role prey prey b42 tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait lexa tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association cytoplasmic domains of Robo1 (AA 939-1345) was fused to B42. Dock was fused to LexA. revisit when protein editor in place. robo-dock-6 2 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Proline rich CC2 (1247-1295) and CC3 (1084-1130) motifs are important for interaction. revisit when protein editor in place. robo-dock-7 2 7 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey physical association physical association Domains SH3-1 and SH3-2 were found to be important for interaction. Robo AA 939-1395 was used in the studies. revisit when protein editor in place.