MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Xenopus cold-inducible RNA-binding protein 2 interacts with ElrA, the Xenopus homolog of HuR, and inhibits deadenylation of specific mRNAs. Xenopus cold-inducible RNA-binding protein 2 interacts with ElrA, the Xenopus homolog of HuR, and inhibits deadenylation of specific mRNAs. J. Biol. Chem. (0021-9258) 2003 Aoki K., Matsumoto K., Tsujimoto M. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Aoki K., Matsumoto K., Tsujimoto M. no J. Biol. Chem. (0021-9258) 2003 Xenopus cold-inducible RNA-binding protein 2 interacts with ElrA, the Xenopus homolog of HuR, and inhibits deadenylation of specific mRNAs. Xenopus cold-inducible RNA-binding protein 2 interacts with ElrA, the Xenopus homolog of HuR, and inhibits deadenylation of specific mRNAs. J. Biol. Chem. (0021-9258) 2003 Aoki K., Matsumoto K., Tsujimoto M. in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Aoki K., Matsumoto K., Tsujimoto M. no J. Biol. Chem. (0021-9258) 2003 Xenopus cold-inducible RNA-binding protein 2 interacts with ElrA, the Xenopus homolog of HuR, and inhibits deadenylation of specific mRNAs. Xenopus cold-inducible RNA-binding protein 2 interacts with ElrA, the Xenopus homolog of HuR, and inhibits deadenylation of specific mRNAs. J. Biol. Chem. (0021-9258) 2003 Aoki K., Matsumoto K., Tsujimoto M. in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Aoki K., Matsumoto K., Tsujimoto M. J. Biol. Chem. (0021-9258) 2003 cirbb_xenla Cold-inducible RNA-binding protein B cirbp cirp2 cirbp-b Cold-inducible RNA-binding protein 2 Glycine-rich RNA-binding protein CIRP-B protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSDEGKLFIGGLNFDTNEESLEQVFSKYGQISEVVVVKDRETKRSRGFGFVTFENPDDAKDAMMAMNGKAVDGRQIRVDQAGKSSGDRRGGYRGGSSGGRGFFRGGRGRGGGDRGYGSSRFDNRSGGYGGSSGSRDYYSSGRSQGSYGDRAGGSYRDSYDSYATHE mint 809B4B247447AEAF elv1a_xenla ELAV-like protein 1-A elavl1-a elavl1 elrA Protein ElrA-A 36 kDa embryonic-type cytoplasmic polyadenylation element-binding protein protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSNGYEDHMDDVCRDDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGFEMRSSSLSKGHSLGYGFVNYLNAKDAERAINTLNGLRLQSKTIKVSFARPSSESIKDANLYISGLPRTMTQKDVEDMFLPFGHIINSRVLVDQATGLSRGVAFIRFDKRSEAEEAIASFNGHKPPGSSEPITVKFAANPNQNKNVALLSQICHSPARRFGGPVHHQAQRFRFSPMGVDHMSSISSVNVASSATSGWCIFVYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKTLQVSFKTSKSHK mint BEE8BF72CF1F03BE cirbp_b-elavl1_a 3 Q9DED4 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 Q91582 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association mint cirbp_b-elavl1_a-1 1 Q9DED4 4 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 Q91582 5 unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 direct interaction direct interaction mint cirbp_b-elavl1_a-2 2 Q9DED4 4 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 Q91582 5 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association mint