MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The interaction between ADAM 22 and 14-3-3zeta: regulation of cell adhesion and spreading. The interaction between ADAM 22 and 14-3-3zeta: regulation of cell adhesion and spreading. Biochem. Biophys. Res. Commun. (0006-291X) 2003 Zhu Pc., Sun Y., Xu R., Sang Y., Zhao J., Liu G., Cai L., Li C., Zhao S. partial coverage rapid curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Zhu Pc., Sun Y., Xu R., Sang Y., Zhao J., Liu G., Cai L., Li C., Zhao S. no Biochem. Biophys. Res. Commun. (0006-291X) 2003 partial coverage rapid curation The interaction between ADAM 22 and 14-3-3zeta: regulation of cell adhesion and spreading. The interaction between ADAM 22 and 14-3-3zeta: regulation of cell adhesion and spreading. Biochem. Biophys. Res. Commun. (0006-291X) 2003 Zhu Pc., Sun Y., Xu R., Sang Y., Zhao J., Liu G., Cai L., Li C., Zhao S. partial coverage rapid curation in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Zhu Pc., Sun Y., Xu R., Sang Y., Zhao J., Liu G., Cai L., Li C., Zhao S. no Biochem. Biophys. Res. Commun. (0006-291X) 2003 partial coverage rapid curation The interaction between ADAM 22 and 14-3-3zeta: regulation of cell adhesion and spreading. The interaction between ADAM 22 and 14-3-3zeta: regulation of cell adhesion and spreading. Biochem. Biophys. Res. Commun. (0006-291X) 2003 Zhu Pc., Sun Y., Xu R., Sang Y., Zhao J., Liu G., Cai L., Li C., Zhao S. partial coverage rapid curation unknown Unknown gallex lex-a dimerization assay gallex predetermined predetermined participant predetermined Zhu Pc., Sun Y., Xu R., Sang Y., Zhao J., Liu G., Cai L., Li C., Zhao S. Biochem. Biophys. Res. Commun. (0006-291X) 2003 partial coverage rapid curation The interaction between ADAM 22 and 14-3-3zeta: regulation of cell adhesion and spreading. The interaction between ADAM 22 and 14-3-3zeta: regulation of cell adhesion and spreading. Biochem. Biophys. Res. Commun. (0006-291X) 2003 Zhu Pc., Sun Y., Xu R., Sang Y., Zhao J., Liu G., Cai L., Li C., Zhao S. partial coverage rapid curation in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zhu Pc., Sun Y., Xu R., Sang Y., Zhao J., Liu G., Cai L., Li C., Zhao S. Biochem. Biophys. Res. Commun. (0006-291X) 2003 partial coverage rapid curation 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN DIP protein P63104 original sequence version: 144 D464DF2286BBFE60 ada22_human Disintegrin and metalloproteinase domain-containing protein 22 Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2 Metalloproteinase-disintegrin ADAM22-3 ADAM22 MDC2 protein protein human Homo sapiens Human MQAAVAVSVPFLLLCVLGTCPPARCGQAGDASLMELEKRKENRFVERQSIVPLRLIYRSGGEDESRHDALDTRVRGDLGGPQLTHVDQASFQVDAFGTSFILDVVLNHDLLSSEYIERHIEHGGKTVEVKGGEHCYYQGHIRGNPDSFVALSTCHGLHGMFYDGNHTYLIEPEENDTTQEDFHFHSVYKSRLFEFSLDDLPSEFQQVNITPSKFILKPRPKRSKRQLRRYPRNVEEETKYIELMIVNDHLMFKKHRLSVVHTNTYAKSVVNMADLIYKDQLKTRIVLVAMETWATDNKFAISENPLITLREFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICSLLKGGGVNEFGKTDLMAVTLAQSLAHNIGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPKKFTQCNIEEYHDFLNSGGGACLFNKPSKLLDPPECGNGFIETGEECDCGTPAECVLEGAECCKKCTLTQDSQCSDGLCCKKCKFQPMGTVCREAVNDCDIRETCSGNSSQCAPNIHKMDGYSCDGVQGICFGGRCKTRDRQCKYIWGQKVTASDKYCYEKLNIEGTEKGNCGKDKDTWIQCNKRDVLCGYLLCTNIGNIPRLGELDGEITSTLVVQQGRTLNCSGGHVKLEEDVDLGYVEDGTPCGPQMMCLEHRCLPVASFNFSTCLSSKEGTICSGNGVCSNELKCVCNRHWIGSDCNTYFPHNDDAKTGITLSGNGVAGTNIIIGIIAGTILVLALILGITAWGYKNYREQRQLPQGDYVKKPGDGDSFYSDIPPGVSTNSASSSKKRSNGLSHSWSERIPDTKHISDICENGRPRSNSWQGNLGGNKKKIRGKRFRPRSNSTETLSPAKSPSSSTGSIASSRKYPYPMPPLPDEDKKVNRQSARLWETSI 265ECCD0FA6C088B ada23_human Disintegrin and metalloproteinase domain-containing protein 23 ADAM23 MDC3 Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3 protein protein human Homo sapiens Human MKPPGSSSRQPPLAGCSLAGASCGPQRGPAGSVPASAPARTPPCRLLLVLLLLPPLAASSRPRAWGAAAPSAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYYINQDSESPYHVLDTKARHQQKHNKAVHLAQASFQIEAFGSKFILDLILNNGLLSSDYVEIHYENGKPQYSKGGEHCYYHGSIRGVKDSKVALSTCNGLHGMFEDDTFVYMIEPLELVHDEKSTGRPHIIQKTLAGQYSKQMKNLTMERGDQWPFLSELQWLKRRKRAVNPSRGIFEEMKYLELMIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAVETWTEKDQIDITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYGLPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGGGACLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHCSDGPCCNNTSCLFQPRGYECRDAVNECDITEYCTGDSGQCPPNLHKQDGYACNQNQGRCYNGECKTRDNQCQYIWGTKAAGSDKFCYEKLNTEGTEKGNCGKDGDRWIQCSKHDVFCGFLLCTNLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLDDDTDVGYVEDGTPCGPSMMCLDRKCLQIQALNMSSCPLDSKGKVCSGHGVCSNEATCICDFTWAGTDCSIRDPVRNLHPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFDPTQQGPI mint May play a role in cell-cell and cell-matrix interactions. This is a non-catalytic metalloprotease-like protein 7841A9670E1C24EF ywhaz-adam22-2 4 ADA22 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Stoichiometry: 1.0 1433Z 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association The isoform 3 of ADAM 22 was utilized (846aa long).rnIn addition, mutations to alanine of the Ser834 and the Ser857, suggest they can be critical for interaction but no clear phosphorylation dependence is shown. rnrn homomint domino mint adam23-ywhaz 4 ADA23 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 1433Z 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association homomint domino mint ywhaz-adam22-3 1 ADA22 6 unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Stoichiometry: 1.0 1433Z 5 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction The isoform 3 of ADAM 22 was utilized (846aa long).rnIn addition, mutations to alanine of the Ser834 and the Ser857, suggest they can be critical for interaction but no clear phosphorylation dependence is shown. rnrn homomint domino mint ywhaz-adam22-4 2 ADA22 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Stoichiometry: 1.0 1433Z 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association The isoform 3 of ADAM 22 was utilized (846aa long).rnIn addition, mutations to alanine of the Ser834 and the Ser857, suggest they can be critical for interaction but no clear phosphorylation dependence is shown. rnrn homomint domino mint adam22-ywhaz-3 3 ADA22_HUMAN 6 unspecified role unspecified role unspecified role unspecified role 1433Z_HUMAN 5 unspecified role unspecified role unspecified role unspecified role physical association physical association homomint domino mint adam22-ywhaz-4 3 ADA22_HUMAN 6 unspecified role unspecified role unspecified role unspecified role 1433Z_HUMAN 5 unspecified role unspecified role unspecified role unspecified role physical association physical association homomint domino mint