IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mbt, a Drosophila PAK protein, combines with Cdc42 to regulate photoreceptor cell morphogenesis. Mbt, a Drosophila PAK protein, combines with Cdc42 to regulate photoreceptor cell morphogenesis. Development (0950-1991) 2003 Schneeberger D., Raabe T. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Schneeberger D., Raabe T. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Development (0950-1991) 2003 Mbt, a Drosophila PAK protein, combines with Cdc42 to regulate photoreceptor cell morphogenesis. Mbt, a Drosophila PAK protein, combines with Cdc42 to regulate photoreceptor cell morphogenesis. Development (0950-1991) 2003 Schneeberger D., Raabe T. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Schneeberger D., Raabe T. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Development (0950-1991) 2003 cdc42_drome Cdc42 homolog CG12530 Cdc42 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLRDENSTLEKLAKNKQKPITMEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPPEPTKKRKCKFL DIP protein P40793 original sequence version: 109 0AB96574ADC8E0E3 pakm_drome Serine/threonine-protein kinase PAK mbt mbt p21-activated kinase-related protein Protein mushroom bodies tiny CG18582 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MFSKKKKKPLISMPSNFEHRVHTGFDKRENKYVGLPLQWASIVGNNQILKSSNRPLPLVDPSEITPTEILDLKTIVRPHHNNNKADTTSLNSSSTMMMGSMAPMNPMAPGAHPMMSHGPGMMMPPETGGIVLPKTSHVARSNSLRSSSPPRVRRVANVPPSVPEEEGPPAAGTPGVGGASSGGFKPPGAHPSLLYNSQHAHANGATGPLAVRTDQTNLQQYRSNLAPPSGGSMPQQQQTSPVGSVASGTRSNHSHTNNGNSGGSYPPMYPTSHQQQQQQQQQAKQGGDQNQNPLHPHAHPHPHHHQHLAKSASRASSSSGGASSAAQQASGASGGAAGQPKQDQRLTHEQFRAALQMVVSAGDPRENLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKMDLRKQQRRELLFNEVVIMRDYHHPNIVETYSSFLVNDELWVVMEYLEGGALTDIVTHSRMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLAADGRVKLSDFGFCAQVSQELPKRKSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMVDGEPPFFNEPPLQAMRRIRDMQPPNLKNAHKVSPRLQSFLDRMLVRDPAQRATAAELLAHPFLRQAGPPSLLVPLMRNARHHP 414D217F0AEEC1C6 mbt-cdc42-1 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association HA tagged Mbt and Myc tagged Cdc42 cdc42-mbt-1 2 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey physical association physical association GST tagged Cdc42 and HA tagged Mbt used in the experiment. Interaction is GTP dependent.