IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Phyllopod acts as an adaptor protein to link the sina ubiquitin ligase to the substrate protein tramtrack. Phyllopod acts as an adaptor protein to link the sina ubiquitin ligase to the substrate protein tramtrack. Mol. Cell. Biol. (0270-7306) 2002 Li S., Xu C., Carthew RW. in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Li S., Xu C., Carthew RW. Equal volumes of 15, 20, 25, and 30% glycerol were overlaid in ultracentrifuge tubes and left overnight to form the density gradient. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Mol. Cell. Biol. (0270-7306) 2002 Phyllopod acts as an adaptor protein to link the sina ubiquitin ligase to the substrate protein tramtrack. Phyllopod acts as an adaptor protein to link the sina ubiquitin ligase to the substrate protein tramtrack. Mol. Cell. Biol. (0270-7306) 2002 Li S., Xu C., Carthew RW. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Li S., Xu C., Carthew RW. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Mol. Cell. Biol. (0270-7306) 2002 Phyllopod acts as an adaptor protein to link the sina ubiquitin ligase to the substrate protein tramtrack. Phyllopod acts as an adaptor protein to link the sina ubiquitin ligase to the substrate protein tramtrack. Mol. Cell. Biol. (0270-7306) 2002 Li S., Xu C., Carthew RW. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Li S., Xu C., Carthew RW. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Mol. Cell. Biol. (0270-7306) 2002 sina_drome E3 ubiquitin-protein ligase sina sina CG9949 Seven in absentia protein RING-type E3 ubiquitin transferase sina protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSNKINPKRREPTAAAAGAGATGVATNTSTSTGSSSAGNTSSANTSSSSSSSLSSAGGGDAGMSADLTSLFECPVCFDYVLPPILQCSSGHLVCVSCRSKLTCCPTCRGPLANIRNLAMEKVASNVKFPCKHSGYGCTASLVYTEKTEHEETCECRPYLCPCPGASCKWQGPLDLVMQHLMMSHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYDGHQQFFAIVQLIGSRKEAENFVYRLELNGNRRRLTWEAMPRSIHEGVASAIHNSDCLVFDTSIAQLFADNGNLGINVTISLV B58D7D5E8DA2F958 ttka_drome Protein tramtrack, alpha isoform ttk FTZ-F2 CG1856 Tramtrack p88 Repressor protein fushi tarazu protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MKMASQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLAVEGQHLKAHKMVLSACSPYFNTLFVSHPEKHPIVILKDVPYSDMKSLLDFMYRGEVSVDQERLTAFLRVAESLRIKGLTEVNDDKPSPAAAAAGAGATGSESTATTPQLQRIQPYLVPQRNRSQAGGLLASAANAGNTPTLPVQPSLLSSALMPKRKRGRPRKLSGSSNGTGNDYDDFDRENMMNDSSDLGNGKMCNESYSGNDDGSDDNQPNAGHTDDLNESRDSLPSKRSKNSKDHRVVSHHEDNSTSVTPTKATPELSQRLFGSSSTTISATAPGGSSTGPSETISLLEISDERESAPVHLPTILGLKIRAINTTTPAQQGSPQTPTKSKPKIRQATGSNNSNSLLKQQLRGGAKDPEVPPATRITGAVTPNAALNAEEQSKEMPKKNQDEVNACIGLHSLANAAEQQAAQVASTGNLHHQLLLHMAANNSMLNTTDYYQQQQQESPSSAGQFMDDDLELLSLNDQQDKSDEPDHEMVTLADENAGLPGYQGNEAEATPAQEDSPAAETATAPPPAPRSGKKGAKRPIQRRRVRRKAQSTLDDQAEHLTEMSVRGLDLFRYASVVEGVYRCTECAKENMQKTFKNKYSFQRHAFLYHEGKHRKVFPCPVCSKEFSRPDKMKNHLKMTHENFTPPKDIGAFSPLKYLISAAAAGDMHATIYQQQQDHYHRQLAEQLEQQNASFDSRDSSLILPDVKMEHAEDQDAEQEAELSDGGYDASNPAAAAAAMLSLQQDVIIKDEIQISPSPSPTPPASCAVAEGKSLALASTAQTAT CF3EE14069C79AA2 phyl_drome Protein phyllopod phyl CG10108 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSTNQQQQANPSAAVAAPAASSEYLKRTCLICGCHTNQTINIYEPRSGPNIVQLIQAKFKFQPLNEDKFLCFSCNNWLINWHSLQAVNSNEAESQSQSPSHMGNSVLQQERTKLRPVAMVRPTVRVQPQSQPQLQPQVPINPTPAPIVYSKRRASRRSASVSRMSRVLRQCCVESLRRSPKKRNQQSVFVCLRPQGQKRSNAICKVECVAPRRKPVERLVKDVAATATPTPVLNTQSTPTYQRFPQPSVDGKVVAMFRRLGTTLSREEPAAYSAESNPACSKLPQIMSPLKEAPRWTRDLDDDEILLEFDTAISEVLPTARYQVTHEENKENQQAQEMELELEEEEEVDGRAELEVVQEAEAPLEPQSHHKQGNSHQNSHQASIQLAGLRLPMGLSISLV DIP protein Q27934 original sequence version: 39 B992F420905407A6 sina-ttk-1 2 5 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Sina is GST tagged. sina-phyl-1 2 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Phyl is GST tagged. phyl-sina-1 3 4 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Phyl is HA tagged. ttk-sina-1 3 5 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Ttk is HA tagged. Interaction of Ttk with Sina is weaker than its interaction with Phyl. sina-sina-1 3 4 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Sina is HA tagged and the immunoprecipitation of untagged Sina observed. ttk-phyl-1 3 6 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Ttk is HA tagged. ttk-sina-2 3 6 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Ttk is HA tagged. phyl-ttk-1 3 6 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fragment AA241-320 of Phyl was sufficient to interact with Ttk. Ttk was HA tagged. revisit when protein editor in place. phyl-sina-2 2 6 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association From mutation analysis, residues 109-127 were found ot be important for the intraction of Phyl with Sina. Sina was GST tagged in this experiment. revisit when protein editor in place. sina-phyl-2 3 6 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fragment AA 167-314 of Sina was sufficient to interact with Phyl. Phyl was HA tagged. revisit when protein editor in place. ttk-phyl-2 3 5 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association N-terminal 122 AA of Ttk were sufficient to interact with HA tagged Phyl. revisit when protein editor in place. sina-phyl-3 1 6 unspecified role unspecified role neutral component neutral component s35 met tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 4 unspecified role unspecified role neutral component neutral component s35 met tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Possibly the complex is made up of dimer of Phyl and dimer of Sina. ttk-phyl-3 1 6 unspecified role unspecified role neutral component neutral component s35 met tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 4 unspecified role unspecified role neutral component neutral component s35 met tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 5 unspecified role unspecified role neutral component neutral component s35 met tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association The three proteins are present in a common multiprotein complex.