MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The gamma-secretase-generated intracellular domain of beta-amyloid precursor protein binds Numb and inhibits Notch signaling. The gamma-secretase-generated intracellular domain of beta-amyloid precursor protein binds Numb and inhibits Notch signaling. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 Roncarati R., Sestan N., Scheinfeld MH., Berechid BE., Lopez PA., Meucci O., McGlade JC., Rakic P., D'Adamio L. no in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Roncarati R., Sestan N., Scheinfeld MH., Berechid BE., Lopez PA., Meucci O., McGlade JC., Rakic P., D'Adamio L. no Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 The gamma-secretase-generated intracellular domain of beta-amyloid precursor protein binds Numb and inhibits Notch signaling. The gamma-secretase-generated intracellular domain of beta-amyloid precursor protein binds Numb and inhibits Notch signaling. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 Roncarati R., Sestan N., Scheinfeld MH., Berechid BE., Lopez PA., Meucci O., McGlade JC., Rakic P., D'Adamio L. no in vivo in vivo fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Roncarati R., Sestan N., Scheinfeld MH., Berechid BE., Lopez PA., Meucci O., McGlade JC., Rakic P., D'Adamio L. no Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 numb_mouse Protein numb homolog Numb protein protein mouse Mus musculus Mouse MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERKFFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPDRNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTATFDASRTTFTREGSFRVTTATEQAEREEIMKQLQDAKKAETDKTVVGPSVAPGNTAPSPSSPTSPTPDGTASSEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINELPSTMQRKTDFPIKNTVPEVEGEAESISSLCSQITSAFSTPSEDPFSSAPMTKPVTLVAPQSPVLQANGTDSASHVLTAKPANTALAHVAMPVRETNPWAHVPDAANKEIAAIHPGTEWGQSSGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQVSAAPLQPVLQPPPPAAIAPPAPPFQGHAFLTSQPVPVGVVPPLQPAFVPTQSYPVANGMPYPASNVPVVGITPSQMVANVFGTAGHPQTTHPHQSPSLAKQQTFPQYETSSATTSPFFKPPAQHLNGSAAFNGVDNGGLASGNRHAEVPPGTCPVDPFEAQWAALESKSKQRTNPSPTNPFSSDLQKTFEIEL 6A2B69AA54B9A928 a4_mouse Amyloid-beta precursor protein App Alzheimer disease amyloid A4 protein homolog ABPP Amyloidogenic glycoprotein Amyloid precursor protein A4 AD1 Alzheimer disease amyloid protein Amyloid-beta (A4) precursor protein Amyloid-beta A4 protein protein protein mouse Mus musculus Mouse MLPSLALLLLAAWTVRALEVPTDGNAGLLAEPQIAMFCGKLNMHMNVQNGKWESDPSGTKTCIGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDSVDSADAEEDDSDVWWGGADTDYADGGEDKVVEVAEEEEVADVEEEEADDDEDVEDGDEVEEEAEEPYEEATERTTSTATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCVPFFYGGCGGNRNNFDTEEYCMAVCGSVSTQSLLKTTSEPLPQDPDKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPHHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHPFGVDSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN 988D89E089092A3E nbl1_mouse Neuroblastoma suppressor of tumorigenicity 1 Nbl1 Dan Dana Zinc finger protein DAN N03 protein protein mouse Mus musculus Mouse MLWVLVGAVLPVMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKIVHCSCQACGKEPSHEGLNVYVQGEDSPGSQPGPHSHAHPHPGGQTPEPEEPPGAPQVEEEGAED mint Possible candidate as a tumor suppressor gene of neuroblastoma. May play an important role in preventing cells from entering the final stage (G1/S) of the transformation process C51D74C82ED904DD app-numb-1 1 4 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 3 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association Data indicate that APP processing may physiologically regulate Notch activity indirectly through Numb homomint mint app-nbl1 1 5 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association Data indicate that APP processing may physiologically regulate Notch activity indirectly through Nbl homomint mint app-nbl1-1 2 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 proximity proximity close-contact colocalization neighbourhood interaction Data indicate that APP processing may physiologically regulate Notch activity indirectly through Nbl homomint mint app-numb-2 2 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 proximity proximity close-contact colocalization neighbourhood interaction Data indicate that APP processing may physiologically regulate Notch activity indirectly through Numb homomint mint