MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Release of U18 snoRNA from its host intron requires interaction of Nop1p with the Rnt1p endonuclease. Release of U18 snoRNA from its host intron requires interaction of Nop1p with the Rnt1p endonuclease. EMBO J. (0261-4189) 2001 Giorgi C., Fatica A., Nagel R., Bozzoni I. no in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Giorgi C., Fatica A., Nagel R., Bozzoni I. no EMBO J. (0261-4189) 2001 Release of U18 snoRNA from its host intron requires interaction of Nop1p with the Rnt1p endonuclease. Release of U18 snoRNA from its host intron requires interaction of Nop1p with the Rnt1p endonuclease. EMBO J. (0261-4189) 2001 Giorgi C., Fatica A., Nagel R., Bozzoni I. no in vitro In vitro pull down pull down predetermined predetermined participant predetermined Giorgi C., Fatica A., Nagel R., Bozzoni I. no EMBO J. (0261-4189) 2001 snr190 yeast small nucleolar RNA 190 yeast snorna small nucleolar rna snoRNA snorna yeast Saccharomyces cerevisiae Baker's yeast GGCCCUGAUGAUAAUGGUGUCUCUUCUUUCCUCGUCCGAUUCGACCAUGACGACAAGGGAUUUUAUCUCGUUCUCUUAAUGCGAAUGAUUUUGAAAAGAUGUUGCUUCUGUGACAUUUUUUUUUAAUCAUUUGUGUUUGCAAACGGGAACUUUUCUUGCCAGUGUUAUACAACACAUGCAGAUCUGAGCC snru14 yeast small nucleolar RNA U14 Yeast snorna small nucleolar rna snoRNA snorna yeast Saccharomyces cerevisiae Baker's yeast UCACGGUGAUGAAAGACUGGUUCCUUAACAUUCGCAGUUUCCACGGUAGGAGUACGCUUACGAACCCAUCGUUAGUACUCUCGGUGACCGCUCUUCUUUAGAGACCUUCCUAGGAUGUCUGAGUGA fbrl_yeast rRNA 2'-O-methyltransferase fibrillarin NOP1 LOT3 YDL014W D2870 U3 small nucleolar RNA-associated protein NOP1 Histone-glutamine methyltransferase protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFRPGSRGGSRGGSRGGFGGRGGSRGGARGGSRGGFGGRGGSRGGARGGSRGGFGGRGGSRGGARGGSRGGRGGAAGGARGGAKVVIEPHRHAGVYIARGKEDLLVTKNMAPGESVYGEKRISVEEPSKEDGVPPTKVEYRVWNPFRSKLAAGIMGGLDELFIAPGKKVLYLGAASGTSVSHVSDVVGPEGVVYAVEFSHRPGRELISMAKKRPNIIPIIEDARHPQKYRMLIGMVDCVFADVAQPDQARIIALNSHMFLKDQGGVVISIKANCIDSTVDAETVFAREVQKLREERIKPLEQLTLEPYERDHCIVVGRYMRSGLKK 56A8B958A7B6066E 56A8B958A7B6066E snr18 yeast small nuclear RNA 18 snorna small nucleolar rna snoRNA snorna yeast Saccharomyces cerevisiae Baker's yeast GUGAAUGAUGAAUUUAAUUCUUUGGUCCGUGUUUAUGAUGGGAAGUAAGACCCCCGAUAUGAGUGACAAAAGAGAUGUGGUUGACUAUCACAGUAUCUGACG rnt1_yeast Ribonuclease 3 RNT1 YMR239C YM9408.01C YM9959.21 Ribonuclease III protein protein yeast Saccharomyces cerevisiae Baker's yeast MGSKVAGKKKTQNDNKLDNENGSQQRENINTKTLLKGNLKISNYKYLEVIQLEHAVTKLVESYNKIIELSPNLVAYNEAVNNQDRVPVQILPSLSRYQLKLAAELKTLHDLKKDAILTEITDYENEFDTEQKQPILQEISKADMEKLEKLEQVKREKREKIDVNVYENLNEKEDEEEDEGEDSYDPTKAGDIVKATKWPPKLPEIQDLAIRARVFIHKSTIKDKVYLSGSEMINAHNERLEFLGDSILNSVMTLIIYNKFPDYSEGQLSTLRMNLVSNEQIKQWSIMYNFHEKLKTNFDLKDENSNFQNGKLKLYADVFEAYIGGLMEDDPRNNLPKIRKWLRKLAKPVIEEATRNQVALEKTDKLDMNAKRQLYSLIGYASLRLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALRDKKMLDFYAKQRAAIPRSESVLKDPSQKNKKRKFSDTS 570294172E66A0DE 570294172E66A0DE nop58_yeast Nucleolar protein 58 Nucleolar protein 5 NOP58 NOP5 YOR310C O6108 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAYVLTETSAGYALLKASDKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAANALEEANSIIEGKVSSQLEKLLEEIKKDKKSTLIVSETKLANAINKLGLNFNVVSDAVTLDIYRAIKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASETDLSEILPEEIEERVKTAAEVSMGTEITQTDLDNINALAEQIVEFAAYREQLSNYLSARMKAIAPNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRLSQLEGRDLRTTPKVVREAKKVEMTEARAYNADADTAKAASDSESDSDDEEEEKKEKKEKKRKRDDDEDSKDSKKAKKEKKDKKEKKEKKEKKEKKEKKEKKEKKSKKEKKEKK 8A2889448B2A19E2 8A2889448B2A19E2 snr38 yeast small nucleolar RNA 38 Yeast snorna small nucleolar rna snoRNA snorna yeast Saccharomyces cerevisiae Baker's yeast CAUAAUGAUGAAAAAAAAUUUUAUCAAACAGUUAUCCCUGUCUGAAUGGGUAAUAAUAGGUAACCUCUCAUAUGUUGAUAUUUGUAUUUCUGAUA nop56_yeast Nucleolar protein 56 SIK1 Ribosome biosynthesis protein SIK1 YLR197W L8167.9 NOP56 Suppressor of I kappa b protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELVSFAPFKGAAEALENANDISEGLVSESLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEEFPYVDCISNELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDDSLHDLAALLNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRIDNYSEEPSNVFGSVLKKQVEQRLEFYNTGKPTLKNELAIQEAMELYNKDKPAAEVEETKEKESSKKRKLEDDDEEKKEKKEKKSKKEKKEKKEKKDKKEKKDKKEKKDKKKKSKD F8522A5870EF4842 F8522A5870EF4842 rnt1-nop1-1 2 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 direct interaction direct interaction Fig 6 - 160.80.34.218 mint nop1_u18-2 2 6 unspecified role unspecified role prey prey label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey tag protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeast Saccharomyces cerevisiae Baker's yeast physical association physical association Fig 2, Fig 3B nop58-snr18 yeast-1 2 8 unspecified role unspecified role bait bait tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeast Saccharomyces cerevisiae Baker's yeast 6 unspecified role unspecified role prey prey label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 2 nop56-snr18 yeast-1 2 10 unspecified role unspecified role bait bait tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeast Saccharomyces cerevisiae Baker's yeast 6 unspecified role unspecified role prey prey label 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 2 rnt1 u18-1 1 5 ancillary ancillary neutral component neutral component tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 enzyme target enzyme target substrate substrate neutral component neutral component 7 enzyme enzyme neutral component neutral component tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Fig 5 B rnt1-snr190 yeast-1 1 3 enzyme target enzyme target substrate substrate neutral component neutral component 7 enzyme enzyme neutral component neutral component gst gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Fig5D rnt1-snru14 yeast-1 1 7 enzyme enzyme neutral component neutral component gst gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 4 enzyme target enzyme target substrate substrate neutral component neutral component enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Fig5D nop1-rnt1-1 1 9 enzyme target enzyme target substrate substrate neutral component neutral component 5 ancillary ancillary neutral component neutral component tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 enzyme enzyme neutral component neutral component tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Fig 5 C