MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The E2F6 transcription factor is a component of the mammalian Bmi1-containing polycomb complex. The E2F6 transcription factor is a component of the mammalian Bmi1-containing polycomb complex. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 Trimarchi JM., Fairchild B., Wen J., Lees JA. no mouse-l cells Mus musculus embryo fibroblast, Moloney Sarcoma Virus transformed l cells Mouse embryo fibroblast, Moloney Sarcoma Virus transformed coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Trimarchi JM., Fairchild B., Wen J., Lees JA. no Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 The E2F6 transcription factor is a component of the mammalian Bmi1-containing polycomb complex. The E2F6 transcription factor is a component of the mammalian Bmi1-containing polycomb complex. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 Trimarchi JM., Fairchild B., Wen J., Lees JA. no in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Trimarchi JM., Fairchild B., Wen J., Lees JA. no Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 The E2F6 transcription factor is a component of the mammalian Bmi1-containing polycomb complex. The E2F6 transcription factor is a component of the mammalian Bmi1-containing polycomb complex. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 Trimarchi JM., Fairchild B., Wen J., Lees JA. no in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Trimarchi JM., Fairchild B., Wen J., Lees JA. no Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 The E2F6 transcription factor is a component of the mammalian Bmi1-containing polycomb complex. The E2F6 transcription factor is a component of the mammalian Bmi1-containing polycomb complex. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 Trimarchi JM., Fairchild B., Wen J., Lees JA. no human-c33a Homo sapiens epihelial cervix carcinoma cells c33a C33A cells epithelial-like cells, grown as monolayer; derived from cervical carcinoma coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Trimarchi JM., Fairchild B., Wen J., Lees JA. no Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 ring1_mouse E3 ubiquitin-protein ligase RING1 Ring1 Ring1A Rnf1 RING finger protein 1 Polycomb complex protein RING1 Transcription repressor Ring1A RING-type E3 ubiquitin transferase RING1 protein protein mouse Mus musculus Mouse MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPMPGSDQTATMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAPKRPRGAGAGASSVGTGGGAAGGACGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLALRIALERRQQQETTEPGGPGGGASDTGGPDGGGGERGVAGGGEGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK 4F274E976974A2D8 pcgf2_human Polycomb group RING finger protein 2 PCGF2 MEL18 RNF110 ZNF144 DNA-binding protein Mel-18 RING finger protein 110 Zinc finger protein 144 protein protein human Homo sapiens Human MHRTTRIKITELNPHLMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQVHKTRPLLSIRSDKTLQDIVYKLVPGLFKDEMKRRRDFYAAYPLTEVPNGSNEDRGEVLEQEKGALSDDEIVSLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRCPAAMTVMHLAKFLRNKMDVPSKYKVEVLYEDEPLKEYYTLMDIAYIYPWRRNGPLPLKYRVQPACKRLTLATVPTPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPATPSHGSPSSHGPPATHPTSPTPPSTASGATTAANGGSLNCLQTPSSTSRGRKMTVNGAPVPPLT DIP protein P35227 original sequence version: 96 DIP protein P35227 original sequence version: 124 A910BCD4C0CE9927 rybp_human RING1 and YY1-binding protein Death effector domain-associated factor YY1 and E4TF1-associated factor 1 Apoptin-associating protein 1 RYBP DEDAF YEAF1 protein protein human Homo sapiens Human MTMGDKKSPTRPKRQAKPAADEGFWDCSVCTFRNSAEAFKCSICDVRKGTSTRKPRINSQLVAQQVAQQYATPPPPKKEKKEKVEKQDKEKPEKDKEISPSVTKKNTNKKTKPKSDILKDPPSEANSIQSANATTKTSETNHTSRPRLKNVDRSTAQQLAVTVGNVTVIITDFKEKTRSSSTSSSTVTSSAGSEQQNQSSSGSESTDKGSSRSSTPKGDMSAVNDESF DIP protein Q8N488 original sequence version: 70 DIP protein Q8N488 original sequence version: 110 EB9593460A3F0F4C e2f6_human Transcription factor E2F6 E2F6 protein protein human Homo sapiens Human MSQQRPARKLPSLLLDPTEETVRRRCRDPINVEGLLPSKIRINLEDNVQYVSMRKALKVKRPRFDVSLVYLTRKFMDLVRSAPGGILDLNKVATKLGVRKRRVYDITNVLDGIDLVEKKSKNHIRWIGSDLSNFGAVPQQKKLQEELSDLSAMEDALDELIKDCAQQLFELTDDKENERLAYVTYQDIHSIQAFHEQIVIAVKAPAETRLDVPAPREDSITVHIRSTNGPIDVYLCEVEQGQTSNKRSEGVGTSSSESTHPEGPEEEENPQQSEELLEVSN DIP protein O75461 original sequence version: 127 DIP protein O75461 original sequence version: 95 DIP protein O75461 original sequence version: 120 539E049C15AD3508 bmi1_human Polycomb complex protein BMI-1 BMI1 PCGF4 RNF51 Polycomb group RING finger protein 4 RING finger protein 51 protein protein human Homo sapiens Human MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG DIP protein P35226 original sequence version: 105 DIP protein P35226 original sequence version: 136 DIP protein P35226 original sequence version: 110 DIP protein P35226 original sequence version: 129 030A7D396BADA543 e2f6-bmi1 4 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F4C BIOSOURCE=C33-A cells homomint mint e2f6-ring1 2 8 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association starting point for coimmunoprecipitation experiments:expression vectors transfection/whole-cell lysates homomint mint e2f6-rybp 3 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association homomint mint e2f6-pcgf2 1 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F4D homomint mint