IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The basic helix-loop-helix transcription factors dHAND and eHAND exhibit dimerization characteristics that suggest complex regulation of function. The basic helix-loop-helix transcription factors dHAND and eHAND exhibit dimerization characteristics that suggest complex regulation of function. J. Biol. Chem. (0021-9258) 2000 Firulli BA., Hadzic DB., McDaid JR., Firulli AB. firullia@UTHSCSA.edu yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Firulli BA., Hadzic DB., McDaid JR., Firulli AB. firullia@UTHSCSA.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2000 The basic helix-loop-helix transcription factors dHAND and eHAND exhibit dimerization characteristics that suggest complex regulation of function. The basic helix-loop-helix transcription factors dHAND and eHAND exhibit dimerization characteristics that suggest complex regulation of function. J. Biol. Chem. (0021-9258) 2000 Firulli BA., Hadzic DB., McDaid JR., Firulli AB. firullia@UTHSCSA.edu in vitro In vitro pull down pull down predetermined predetermined participant predetermined Firulli BA., Hadzic DB., McDaid JR., Firulli AB. firullia@UTHSCSA.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2000 The basic helix-loop-helix transcription factors dHAND and eHAND exhibit dimerization characteristics that suggest complex regulation of function. The basic helix-loop-helix transcription factors dHAND and eHAND exhibit dimerization characteristics that suggest complex regulation of function. J. Biol. Chem. (0021-9258) 2000 Firulli BA., Hadzic DB., McDaid JR., Firulli AB. firullia@UTHSCSA.edu in vitro In vitro pull down pull down predetermined predetermined participant predetermined Firulli BA., Hadzic DB., McDaid JR., Firulli AB. firullia@UTHSCSA.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2000 The basic helix-loop-helix transcription factors dHAND and eHAND exhibit dimerization characteristics that suggest complex regulation of function. The basic helix-loop-helix transcription factors dHAND and eHAND exhibit dimerization characteristics that suggest complex regulation of function. J. Biol. Chem. (0021-9258) 2000 Firulli BA., Hadzic DB., McDaid JR., Firulli AB. firullia@UTHSCSA.edu yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Firulli BA., Hadzic DB., McDaid JR., Firulli AB. firullia@UTHSCSA.edu Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Biol. Chem. (0021-9258) 2000 hand2_mouse Heart- and neural crest derivatives-expressed protein 2 Hand2 Dhand Hed Thing2 Deciduum, heart, autonomic nervous system and neural crest derivatives-expressed protein 2 Helix-loop-helix transcription factor expressed in embryo and deciduum Thing-2 protein protein mouse Mus musculus Mouse MSLVGGFPHHPVVHHEGYPFAAAAAAAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYASGAAGLDHSHYGGVPPGAGPPGLGGPRPVKRRGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ 528F541BB2173F1E hey1_mouse Hairy/enhancer-of-split related with YRPW motif protein 1 Hey1 Hesr1 Herp2 Hrt1 Hairy and enhancer of split-related protein 1 Hairy-related transcription factor 1 protein protein mouse Mus musculus Mouse MKRAHPDYSSSDSELDETIEVEKESADENGNLSSALCSMSPTTSSQVLARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLLVRLVSHLNNYASQREAASGAHGGLGHIPWGSAFGHHPHIAHPLLLPQNGHGNAGTAASPTEPHHQGRLASAHPEAPALRAPPSGGLGPVLPVVTSASKLSPPLLSSVASLSAFPFSFSSFHLLSPSTPTQAANLGKPYRPWGTEIGAF 99111DD24ACEE819 hand1_mouse Heart- and neural crest derivatives-expressed protein 1 Hand1 Ehand Hxt Thing1 Extraembryonic tissues, heart, autonomic nervous system and neural crest derivatives-expressed protein 1 Helix-loop-helix transcription factor expressed in extraembryonic mesoderm and trophoblast Thing-1 protein protein mouse Mus musculus Mouse MNLVGSYAHHHHHHHSHPPHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGGPPPTTAVAAAAYGPDARPSQSPGRLEALGSRLPKRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQAGDPEAFKAELKKTDGGRESKRKRELPQQPESFPPASGPGEKRIKGRTGWPQQVWALELNQ 307B14BB835833F1 hey2_mouse Hairy/enhancer-of-split related with YRPW motif protein 2 Hey2 Chf1 Hrt2 Herp Herp1 Hesr2 Hairy and enhancer of split-related protein 2 Hairy-related transcription factor 2 Protein gridlock homolog HES-related repressor protein 2 protein protein mouse Mus musculus Mouse MKRPCEETTSESDLDETIDVGSENNYPGHATSSVMRSNSPTTTSQIMARKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALATDFMSIGFRECLTEVARYLSSVEGLDPSDPLRVRLVSHLSTCASQREAAVMTSSMAHHHHPLHPHHWAAAFHHLPTALLQPNGLHTSESTPCRLSTSSEVPSAHGSALLTATFAHADSALRMPSGGTVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPSNAAAAAAVAAATAISPPLSVSAASSPQQTSTGTNNKPYQPWGTEVGAF 105BEEA06DE50444 tfe2_mouse Transcription factor E2-alpha Tcf3 Alf2 Me2 Tcfe2a Immunoglobulin enhancer-binding factor E12/E47 Transcription factor 3 Transcription factor A1 protein protein mouse Mus musculus Mouse MMNQSQRMAPVGSDKELSDLLDFSMMFPLPVANGKSRPASLGGTQFAGSGLEDRPSSGSWGSSDQNSSSFDPSRTYSEGAHFSDSHSSLPPSTFLGAGLGGKGSERNAYATFGRDTSVGTLSQAGFLPGELSLSSPGPLSPSGIKSSSQYYPSFPSNPRRRAADGGLDTQPKKVRKVPPGLPSSVYPPSSGDSYSRDAAAYPSAKTPSSAYPSPFYVADGSLHPSAELWSTPSQVGFGPMLGDGSSPLPLAPGSSSVGSGTFGGLQQQDRMGYQLHGSEVNGSLPAVSSFSAAPGTYSGTSGHTPPVSGAAAESLLGTRGTTASSSGDALGKALASIYSPDHSSNNFSPSPSTPVGSPQGLPGTSQWPRAGAPSALSPNYDAGLHGLSKMEDRLDEAIHVLRSHAVGTASDLHGLLPGHGALTTSFTGPMSLGGRHAGLVGGSHPEEGLTSGASLLHNHASLPSQPSSLPDLSQRPPDSYSGLGRAGTTAGASEIKREEKEDEEIASVADAEEDKKDLKVPRTRTSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLSSEKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQLALSAAHPGLGEAHNPAGHL DIP protein P15806 original sequence version: 110 7904ABB37B8D39CB heyl_mouse Hairy/enhancer-of-split related with YRPW motif-like protein Heyl Hesr3 Hrt3 Hairy-related transcription factor 3 Hairy and enhancer of split-related protein 3 protein protein mouse Mus musculus Mouse MKRPRAPSGSDGESDGPIDVGQENDLSQMARPLTTPSPSQMQARKKRRGIIEKRRRDRINSSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHASGGTGFFDARALAVDFRSIGFRECLTEVIRYLGVLEGPSSHADPVRIRLLSHLKSYAAEMEPSPTTTSALAFPVWPWSFLHSCPGLPSLNSQLAILGRVPGPVLPSISSPPYPISALRSAPVHRPAGTIPPTRRNLLPSRGVTSTQRAHLPERPAAPPPTALDARAARSIVPIPPCSPTTAPGAGKSDDNVSGSISSPCPSGPTGRPAGAVFYHSWVSEITEIGAF E7F71F1A1F8E00A3 hand1-tcf3 4 7 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association hand1-hand1-1 4 7 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association hand1-hand2-1 1 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association bHLH domain of HAND2 used Revisit when ProteinEditor in place hand2-tcf3 1 9 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association bHLH domain of HAND2 was used hand1-hand2-2 2 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association HAND1 expressed as GST fusion in bacteria BL21 HAND2 was in vitro translated using TNT rabbit reticulocyte lysate system. hand1-hand1-2 2 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association HAND1 expressed as GST fusion in bacteria BL21. HAND1 was in vitro translated using TNT rabbit reticulocyte lysate system. hand1-tcf3-2 2 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association HAND1 expressed as GST fusion in bacteria BL21. TCF3 was in vitro translated using TNT rabbit reticulocyte lysate system. hand1-chf1 2 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association HAND1 expressed as GST fusion in bacteria BL21. CHF1 was in vitro translated using TNT rabbit reticulocyte lysate system. hand1-heyl 2 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association HEYL was in vitro translated using TNT rabbit reticulocyte lysate system. HAND1 expressed as GST fusion in bacteria BL21. hand2-hand2 3 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association HAND2 was in vitro translated using TNT rabbit reticulocyte lysate system. HAND2 expressed as GST fusion in bacteria BL21. hand2-hand1-3 3 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association HAND2 expressed as GST fusion in bacteria BL21. HAND1 was in vitro translated using TNT rabbit reticulocyte lysate system. hand2-tcf3-2 3 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association HAND2 expressed as GST fusion in bacteria BL21. TCF3 was in vitro translated using TNT rabbit reticulocyte lysate system. hand2-chf1 3 8 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association CHF1 was in vitro translated using TNT rabbit reticulocyte lysate system. HAND2 expressed as GST fusion in bacteria BL21 hand2-hey1 3 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association HAND2 expressed as GST fusion in bacteria BL21 HEY1 was in vitro translated using TNT rabbit reticulocyte lysate system. hand2-heyl 3 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association