MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it 14-3-3zeta interacts with the alpha-chain of human interleukin 9 receptor. 14-3-3zeta interacts with the alpha-chain of human interleukin 9 receptor. Biochem. J. (0264-6021) 2000 Sliva D., Gu M., Zhu YX., Chen J., Tsai S., Du X., Yang YC. partial coverage rapid curation in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Sliva D., Gu M., Zhu YX., Chen J., Tsai S., Du X., Yang YC. no Biochem. J. (0264-6021) 2000 partial coverage rapid curation 14-3-3zeta interacts with the alpha-chain of human interleukin 9 receptor. 14-3-3zeta interacts with the alpha-chain of human interleukin 9 receptor. Biochem. J. (0264-6021) 2000 Sliva D., Gu M., Zhu YX., Chen J., Tsai S., Du X., Yang YC. partial coverage rapid curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Sliva D., Gu M., Zhu YX., Chen J., Tsai S., Du X., Yang YC. no Biochem. J. (0264-6021) 2000 partial coverage rapid curation 14-3-3zeta interacts with the alpha-chain of human interleukin 9 receptor. 14-3-3zeta interacts with the alpha-chain of human interleukin 9 receptor. Biochem. J. (0264-6021) 2000 Sliva D., Gu M., Zhu YX., Chen J., Tsai S., Du X., Yang YC. partial coverage rapid curation in vitro In vitro experimental interac experimental interaction detection experimental interac predetermined predetermined participant predetermined Sliva D., Gu M., Zhu YX., Chen J., Tsai S., Du X., Yang YC. no Biochem. J. (0264-6021) 2000 partial coverage rapid curation 14-3-3zeta interacts with the alpha-chain of human interleukin 9 receptor. 14-3-3zeta interacts with the alpha-chain of human interleukin 9 receptor. Biochem. J. (0264-6021) 2000 Sliva D., Gu M., Zhu YX., Chen J., Tsai S., Du X., Yang YC. partial coverage rapid curation in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sliva D., Gu M., Zhu YX., Chen J., Tsai S., Du X., Yang YC. Biochem. J. (0264-6021) 2000 partial coverage rapid curation 14-3-3zeta interacts with the alpha-chain of human interleukin 9 receptor. 14-3-3zeta interacts with the alpha-chain of human interleukin 9 receptor. Biochem. J. (0264-6021) 2000 Sliva D., Gu M., Zhu YX., Chen J., Tsai S., Du X., Yang YC. partial coverage rapid curation unknown Unknown coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Sliva D., Gu M., Zhu YX., Chen J., Tsai S., Du X., Yang YC. no Biochem. J. (0264-6021) 2000 partial coverage rapid curation 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN DIP protein P63104 original sequence version: 144 D464DF2286BBFE60 il9r_human Interleukin-9 receptor IL9R protein protein human Homo sapiens Human MGLGRCIWEGWTLESEALRRDMGTWLLACICICTCVCLGVSVTGEGQGPRSRTFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWPGNTLVAVSIFLLLTGPTYLLFKLSPRVKRIFYQNVPSPAMFFQPLYSVHNGNFQTWMGAHGAGVLLSQDCAGTPQGALEPCVQEATALLTCGPARPWKSVALEEEQEGPGTRLPGNLSSEDVLPAGCTEWRVQTLAYLPQEDWAPTSLTRPAPPDSEGSRSSSSSSSSNNNNYCALGCYGGWHLSALPGNTQSSGPIPALACGLSCDHQGLETQQGVAWVLAGHCQRPGLHEDLQGMLLPSVLSKARSWTF 07C40436466173F3 il9r-ywhaz 4 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed phosphothreonine o-phospho-threonine opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain range MINT-382108: original sequence: 521-521 : SVLSKARSWT tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range MINT-382104: original sequence: 518-522 : LLPSVLSKARSWT [EBI-7174961]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 522-522, sequence length 521 [EBI-7174961]518-522 phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-382106: original sequence: 519-519 : LPSVLSKARSWT Stoichiometry: 1.0 physical association physical association homomint domino mint il9r-ywhaz-1 3 7 unspecified role unspecified role unspecified role unspecified role purified purified phosphothreonine o-phospho-threonine opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain range MINT-382130: original sequence: 521-521 : SVLSKARSWT phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-382128: original sequence: 519-519 : LPSVLSKARSWT binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range MINT-382126: original sequence: 518-522 : LLPSVLSKARSWT [EBI-7175035]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 522-522, sequence length 521 [EBI-7175035]518-522 Stoichiometry: 1.0 6 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 association association homomint domino mint il9r-ywhaz-2 1 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-382146: original sequence: 519-519 : LPSVLSKARSWT binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range MINT-382144: original sequence: 518-522 : LLPSVLSKARSWT [EBI-7175066]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 522-522, sequence length 521 [EBI-7175066]518-522 phosphothreonine o-phospho-threonine opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain range MINT-382148: original sequence: 521-521 : SVLSKARSWT Stoichiometry: 1.0 physical association physical association homomint domino mint il9r-ywhaz-3 2 6 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 7 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range MINT-382160: original sequence: 518-522 : LLPSVLSKARSWT [EBI-7175097]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 522-522, sequence length 521 [EBI-7175097]518-522 phosphothreonine o-phospho-threonine opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain range MINT-382164: original sequence: 521-521 : SVLSKARSWT phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-382162: original sequence: 519-519 : LPSVLSKARSWT Stoichiometry: 1.0 direct interaction direct interaction homomint domino mint il9r-ywhaz-4 5 IL9R_HUMAN 7 unspecified role unspecified role unspecified role unspecified role 1433Z_HUMAN 6 unspecified role unspecified role unspecified role unspecified role association association homomint domino mint