IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Lad, an adapter protein interacting with the SH2 domain of p56lck, is required for T cell activation. Lad, an adapter protein interacting with the SH2 domain of p56lck, is required for T cell activation. J. Immunol. (0022-1767) 1999 Choi YB., Kim CK., Yun Y. in vitro In vitro pull down pull down polyclonal western polyclonal antibody western blot polyclonal western Choi YB., Kim CK., Yun Y. Jurkat T-cell line lysate used as source of SH2D2A Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Immunol. (0022-1767) 1999 Lad, an adapter protein interacting with the SH2 domain of p56lck, is required for T cell activation. Lad, an adapter protein interacting with the SH2 domain of p56lck, is required for T cell activation. J. Immunol. (0022-1767) 1999 Choi YB., Kim CK., Yun Y. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid protein sequence protein sequence identification protein sequence Choi YB., Kim CK., Yun Y. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Immunol. (0022-1767) 1999 Lad, an adapter protein interacting with the SH2 domain of p56lck, is required for T cell activation. Lad, an adapter protein interacting with the SH2 domain of p56lck, is required for T cell activation. J. Immunol. (0022-1767) 1999 Choi YB., Kim CK., Yun Y. mouse-el4 Mus musculus el4 Mouse ascites lymphoma lymphoblast line coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Choi YB., Kim CK., Yun Y. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Immunol. (0022-1767) 1999 Lad, an adapter protein interacting with the SH2 domain of p56lck, is required for T cell activation. Lad, an adapter protein interacting with the SH2 domain of p56lck, is required for T cell activation. J. Immunol. (0022-1767) 1999 Choi YB., Kim CK., Yun Y. human-jurkat Homo sapiens jurkat Human T cell leukemia coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Choi YB., Kim CK., Yun Y. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). J. Immunol. (0022-1767) 1999 sh22a_mouse SH2 domain-containing protein 2A Sh2d2a Lad Ribp Lck-associated adapter protein Rlk/Itk-binding protein protein protein mouse Mus musculus Mouse MEFCLAQPCPQGNHEATSSTFNTFQPMNLTQGRCQNLSCGSRPSMQVMKEQGVQLSPRTNHTVVSASAPGTAWVLGNADRAEEVPGKGDLSLQAETRAWVQKTQAHWLLLKTAPLWFHGFITRREAERLLQPQPLGCYLVRFSESAVTFVLSYRSQTCCRHFLLAQLGDGRHVVLGEDSAHAQLQDLLEHYTECPLSPYGEILTQPLARQTAEPAGLSLRADSDSGSKRQDPDTQLSLLLQQGQAQASGHTEKVWASQQKATSQASRPRPPIPAKPQLPPEVYTSPASRLHQAPPINPIYQEPDEPIAFYAMGRGSPGDAPSNIYAEVEGPSGTAPIGHPILRKCWSRPISRGQVREVQGKISSRSRAERGSPS 6215FF96CE764359 lck_mouse Proto-oncogene tyrosine-protein kinase LCK Lck Lsk-t Lymphocyte cell-specific protein-tyrosine kinase p56-LCK Leukocyte C-terminal Src kinase protein protein mouse Mus musculus Mouse MGCVCSSNPEDDWMENIDVCENCHYPIVPLDSKISLPIRNGSEVRDPLVTYEGSLPPASPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLDNGGFYISPRITFPGLHDLVRHYTNASDGLCTKLSRPCQTQKPQKPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHPRLVRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLNVNKLLDMAAQIAEGMAFIEEQNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYHLMMLCWKERPEDRPTFDYLRSVLDDFFTATEGQYQPQP 3513102F49A7FD0B lck_human Tyrosine-protein kinase Lck Protein YT16 Proto-oncogene Lck T cell-specific protein-tyrosine kinase LCK Lymphocyte cell-specific protein-tyrosine kinase p56-LCK Leukocyte C-terminal Src kinase protein protein human Homo sapiens Human MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRLVRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQPQP DIP protein P06239 original sequence version: 164 DIP protein P06239-1 original sequence version: 193 44BFF0D43FFB420D sh22a_human SH2 domain-containing protein 2A T cell-specific adapter protein VEGF receptor-associated protein SH2 domain-containing adapter protein SH2D2A SCAP TSAD VRAP protein protein human Homo sapiens Human MEFPLAQICPQGSHEAPIPTFSTFQITDMTRRSCQNLGYTAASPQAPEAASNTGNAERAEEVPGEGSLFLQAETRAWFQKTQAHWLLQHGAAPAWFHGFITRREAERLLEPKPQGCYLVRFSESAVTFVLTYRSRTCCRHFLLAQLRDGRHVVLGEDSAHARLQDLLLHYTAHPLSPYGETLTEPLARQTPEPAGLSLRTEESNFGSKSQDPNPQYSPIIKQGQAPVPMQKEGAGEKEPSQLLRPKPPIPAKPQLPPEVYTIPVPRHRPAPRPKPSNPIYNEPDEPIAFYAMGRGSPGEAPSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQNTGGSQLHSENSVIGQGPPLPHQPPPAWRHTLPHNLSRQVLQDRGQAWLPLGPPQ 986670BE084072CB lck-lad 2 6 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P06240:p.Tyr505Phe mutation mutation certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 15:28:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr505phe' Tue Jun 30 15:51:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr505Phe' 5 unspecified role unspecified role prey prey physical association physical association Lck - Tyr505 to Phe mutation makes enzyme constitutively active lck-lad-4 1 6 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag certain certain sequence position certain certain certain sequence position certain sh2 domain binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey human-jurkat Homo sapiens jurkat Human T cell leukemia physical association physical association Anti-CD3/CD4 SH2A/Lad is phosphorylated upon TCR-stimulation - probably by Lck lck-lad-1 3 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Anti-CD3. SH2D2A/Lad associates with p56lck upon TCR stimulation SH2A/Lad is phosphorylated upon TCR-stimulation - probably by Lck lck-lad-2 3 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Anti-CD3. SH2D2A/Lad associates with p56lck upon TCR stimulation SH2A/Lad is phosphorylated upon TCR-stimulation - probably by Lck lck-lad-3 4 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Anti-CD3. SH2D2A/Lad associates with p56lck upon TCR stimulation SH2A/Lad is phosphorylated upon TCR-stimulation - probably by Lck