MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Akt promotes cell survival by phosphorylating and inhibiting a Forkhead transcription factor. Akt promotes cell survival by phosphorylating and inhibiting a Forkhead transcription factor. Cell (0092-8674) 1999 imex curation Brunet A., Bonni A., Zigmond MJ., Lin MZ., Juo P., Hu LS., Anderson MJ., Arden KC., Blenis J., Greenberg ME. Origin of AKT1 traced to PMID:10102273 Only protein-protein interactions imex curation in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Brunet A., Bonni A., Zigmond MJ., Lin MZ., Juo P., Hu LS., Anderson MJ., Arden KC., Blenis J., Greenberg ME. Cell (0092-8674) 1999 IMEx Akt promotes cell survival by phosphorylating and inhibiting a Forkhead transcription factor. Akt promotes cell survival by phosphorylating and inhibiting a Forkhead transcription factor. Cell (0092-8674) 1999 imex curation Brunet A., Bonni A., Zigmond MJ., Lin MZ., Juo P., Hu LS., Anderson MJ., Arden KC., Blenis J., Greenberg ME. Origin of AKT1 traced to PMID:10102273 Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Brunet A., Bonni A., Zigmond MJ., Lin MZ., Juo P., Hu LS., Anderson MJ., Arden KC., Blenis J., Greenberg ME. Cell (0092-8674) 1999 IMEx foxo3_human Forkhead box protein O3 FOXO3 FKHRL1 FOXO3A Forkhead in rhabdomyosarcoma-like 1 AF6q21 protein protein protein human Homo sapiens Human MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLSGGTQALLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSSDELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSSSASLSPSVSKPCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSHSDVMMTQSDPLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQGALGGSRALSNSVSNMGLSESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG E5B4E830665A9982 DIP protein O43524 original sequence version: 82 E5B4E830665A9982 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN DIP protein P63104 original sequence version: 144 D464DF2286BBFE60 akt1_human RAC-alpha serine/threonine-protein kinase AKT1 PKB RAC RAC-PK-alpha Protein kinase B Proto-oncogene c-Akt Protein kinase B alpha protein protein human Homo sapiens Human MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA DIP protein P31749 original sequence version: 184 DIP protein P31749 original sequence version: 168 DIP protein P31749 original sequence version: 102 DIP protein P31749 original sequence version: 110 DIP protein P31749 original sequence version: 160 DIP protein P31749 original sequence version: 136 DIP protein P31749 original sequence version: 175 DIP protein P31749 original sequence version: 201 DIP protein P31749 original sequence version: 166 DIP protein P31749 original sequence version: 178 DIP protein P31749-1 original sequence version: 194 DIP protein P31749 original sequence version: 106 DIP protein P31749 original sequence version: 141 6EAFF4F8AD436714 ywhaz-foxo3-1 2 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed O43524:p.Thr32Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T A Wed May 02 17:49:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr32ala' Tue Jun 30 15:53:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr32Ala' range MINT-365930: original sequence: 32-32 : FEPQSRPRSCTWPLQRPELQ O43524:p.Ser253Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S A Wed May 02 18:43:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser253ala' Tue Jun 30 19:19:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser253Ala' range MINT-365932: original sequence: 253-253 : SGKAPRRRAVSMDNSNKYTK region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O43524:p.Ser315Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Wed May 02 18:52:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser315ala' Tue Jun 30 20:24:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser315Ala' O43524:p.[Thr32Ala;Ser253Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A Wed May 02 14:58:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr32ala,ser253ala' Tue Jun 30 18:31:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr32Ala;Ser253Ala]' Stoichiometry: 1.0 physical association physical association Fig. 4 Mutagenesis to alanine of the threo32 or ser253 abolish binding homomint domino mint akt1-foxo3-2 1 FOXO3_HUMAN 3 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O43524:p.Ser315Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:14:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser315ala' Tue Jun 30 19:45:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser315Ala' O43524:p.Thr32Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain T A Wed May 02 15:04:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr32ala' Tue Jun 30 18:58:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr32Ala' O43524:p.Ser253Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain S A Wed May 02 16:39:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser253ala' Tue Jun 30 16:50:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser253Ala' ecoli Escherichia coli (strain K12) 1433Z_HUMAN 5 enzyme enzyme unspecified role unspecified role region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P31749:p.Lys179Met mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain K M Wed May 02 16:28:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys179met' Tue Jun 30 17:31:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys179Met' phosphorylation phosphorylation reaction phosphorylation Fig. 1 P31749 (GO:0004672) decreases activity of O43524 (GO:0001228)