MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it MAPKK-independent activation of p38alpha mediated by TAB1-dependent autophosphorylation of p38alpha. MAPKK-independent activation of p38alpha mediated by TAB1-dependent autophosphorylation of p38alpha. Science (0036-8075) 2002 Ge B., Gram H., Di Padova F., Huang B., New L., Ulevitch RJ., Luo Y., Han J. no in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Ge B., Gram H., Di Padova F., Huang B., New L., Ulevitch RJ., Luo Y., Han J. no Science (0036-8075) 2002 MAPKK-independent activation of p38alpha mediated by TAB1-dependent autophosphorylation of p38alpha. MAPKK-independent activation of p38alpha mediated by TAB1-dependent autophosphorylation of p38alpha. Science (0036-8075) 2002 Ge B., Gram H., Di Padova F., Huang B., New L., Ulevitch RJ., Luo Y., Han J. no in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ge B., Gram H., Di Padova F., Huang B., New L., Ulevitch RJ., Luo Y., Han J. no Science (0036-8075) 2002 mk14_human Mitogen-activated protein kinase 14 Mitogen-activated protein kinase p38 alpha Cytokine suppressive anti-inflammatory drug-binding protein MAX-interacting protein 2 MAP kinase MXI2 SAPK2A MAPK14 CSBP CSBP1 CSBP2 CSPB1 MXI2 Stress-activated protein kinase 2a protein protein human Homo sapiens Human MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES 286C81D0487618B3 tab1_human TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 TAB1 MAP3K7IP1 TGF-beta-activated kinase 1-binding protein 1 Mitogen-activated protein kinase kinase kinase 7-interacting protein 1 protein protein human Homo sapiens Human MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLESIDDALAEKASLQSQLPEGVPQHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYVANVGTNRALLCKSTVDGLQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIICGQESTRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAHGPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERARFCPRHEDMTLLVRNFGYPLGEMSQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNGAHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFAEFYRLWSVDHGEQSVVTAP DIP protein Q15750 original sequence version: 74 DIP protein Q15750 original sequence version: 110 DIP protein Q15750 original sequence version: 111 A45743288718983A mapk14-tab1-1 1 TAB1 4 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-711765: original sequence: 373-418 : SQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQM Stoichiometry: 1.0 MK14 3 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association homomint mint mapk14-tab1-2 2 TAB1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-711781: original sequence: 373-418 : SQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQM tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 MK14 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association homomint mint