MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it 14-3-3tau associates with and activates the MEF2D transcription factor during muscle cell differentiation. 14-3-3tau associates with and activates the MEF2D transcription factor during muscle cell differentiation. Nucleic Acids Res. (0305-1048) 2001 rapid curation Choi SJ., Park SY., Han TH. 30-Sept-2013: Contacted by IntAct-Help. partial coverage rapid curation in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Choi SJ., Park SY., Han TH. no Accepted 2013-SEP-26 by MARTA 30-Sept-2013: Contacted by IntAct-Help. Nucleic Acids Res. (0305-1048) 2001 partial coverage rapid curation rapid curation 14-3-3tau associates with and activates the MEF2D transcription factor during muscle cell differentiation. 14-3-3tau associates with and activates the MEF2D transcription factor during muscle cell differentiation. Nucleic Acids Res. (0305-1048) 2001 rapid curation Choi SJ., Park SY., Han TH. 30-Sept-2013: Contacted by IntAct-Help. partial coverage rapid curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Choi SJ., Park SY., Han TH. no Accepted 2013-SEP-26 by MARTA 30-Sept-2013: Contacted by IntAct-Help. Nucleic Acids Res. (0305-1048) 2001 partial coverage rapid curation rapid curation 14-3-3tau associates with and activates the MEF2D transcription factor during muscle cell differentiation. 14-3-3tau associates with and activates the MEF2D transcription factor during muscle cell differentiation. Nucleic Acids Res. (0305-1048) 2001 rapid curation Choi SJ., Park SY., Han TH. 30-Sept-2013: Contacted by IntAct-Help. partial coverage rapid curation in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Choi SJ., Park SY., Han TH. Accepted 2013-SEP-26 by MARTA 30-Sept-2013: Contacted by IntAct-Help. Nucleic Acids Res. (0305-1048) 2001 partial coverage rapid curation rapid curation 14-3-3tau associates with and activates the MEF2D transcription factor during muscle cell differentiation. 14-3-3tau associates with and activates the MEF2D transcription factor during muscle cell differentiation. Nucleic Acids Res. (0305-1048) 2001 rapid curation Choi SJ., Park SY., Han TH. 30-Sept-2013: Contacted by IntAct-Help. partial coverage rapid curation unknown Unknown coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Choi SJ., Park SY., Han TH. no Accepted 2013-SEP-26 by MARTA 30-Sept-2013: Contacted by IntAct-Help. Nucleic Acids Res. (0305-1048) 2001 partial coverage rapid curation rapid curation mef2d_human Myocyte-specific enhancer factor 2D MEF2D protein protein human Homo sapiens Human MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTDMDKVLLKYTEYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSPLLEDKYRRASEELDGLFRRYGSTVPAPNFAMPVTVPVSNQSSLQFSNPSGSLVTPSLVTSSLTDPRLLSPQQPALQRNSVSPGLPQRPASAGAMLGGDLNSANGACPSPVGNGYVSARASPGLLPVANGNSLNKVIPAKSPPPPTHSTQLGAPSRKPDLRVITSQAGKGLMHHLTEDHLDLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFSSPGGLSLGNVTAWQQPQQPQQPQQPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSPLPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYETGDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK 5C9790AD598619BA 1433t_rat 14-3-3 protein theta Ywhaq 14-3-3 protein tau protein protein rat Rattus norvegicus (Rat) Rat MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN E30471260E8B366E 1433t_human 14-3-3 protein theta YWHAQ 14-3-3 protein tau 14-3-3 protein T-cell Protein HS1 protein protein human Homo sapiens Human MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN DIP protein P27348 original sequence version: 164 DIP protein P27348 original sequence version: 173 175534325E9E37C4 mef2d-ywhaq 3 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-580263: original sequence: 1-86 : MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTDMDKVLLKYTEYNEPHESRTNADII Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association mint mef2d-ywhaq-1 2 6 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 5 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-580282: original sequence: 1-86 : MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTDMDKVLLKYTEYNEPHESRTNADII Stoichiometry: 1.0 direct interaction direct interaction mint mef2d-ywhaq-2 1 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-580295: original sequence: 1-86 : MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTDMDKVLLKYTEYNEPHESRTNADII Stoichiometry: 1.0 physical association physical association mint mef2d-ywhaq-3 4 1433T_HUMAN 7 unspecified role unspecified role unspecified role unspecified role MEF2D_HUMAN 5 unspecified role unspecified role unspecified role unspecified role association association homomint domino mint