MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Caveolin-3 directly interacts with the C-terminal tail of beta -dystroglycan. Identification of a central WW-like domain within caveolin family members. Caveolin-3 directly interacts with the C-terminal tail of beta -dystroglycan. Identification of a central WW-like domain within caveolin family members. J. Biol. Chem. (0021-9258) 2000 Sotgia F., Lee JK., Das K., Bedford M., Petrucci TC., Macioce P., Sargiacomo M., Bricarelli FD., Minetti C., Sudol M., Lisanti MP. no in vivo in vivo imaging technique imaging technique microscopy predetermined predetermined participant predetermined Sotgia F., Lee JK., Das K., Bedford M., Petrucci TC., Macioce P., Sargiacomo M., Bricarelli FD., Minetti C., Sudol M., Lisanti MP. no J. Biol. Chem. (0021-9258) 2000 Caveolin-3 directly interacts with the C-terminal tail of beta -dystroglycan. Identification of a central WW-like domain within caveolin family members. Caveolin-3 directly interacts with the C-terminal tail of beta -dystroglycan. Identification of a central WW-like domain within caveolin family members. J. Biol. Chem. (0021-9258) 2000 Sotgia F., Lee JK., Das K., Bedford M., Petrucci TC., Macioce P., Sargiacomo M., Bricarelli FD., Minetti C., Sudol M., Lisanti MP. no in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Sotgia F., Lee JK., Das K., Bedford M., Petrucci TC., Macioce P., Sargiacomo M., Bricarelli FD., Minetti C., Sudol M., Lisanti MP. no J. Biol. Chem. (0021-9258) 2000 Caveolin-3 directly interacts with the C-terminal tail of beta -dystroglycan. Identification of a central WW-like domain within caveolin family members. Caveolin-3 directly interacts with the C-terminal tail of beta -dystroglycan. Identification of a central WW-like domain within caveolin family members. J. Biol. Chem. (0021-9258) 2000 Sotgia F., Lee JK., Das K., Bedford M., Petrucci TC., Macioce P., Sargiacomo M., Bricarelli FD., Minetti C., Sudol M., Lisanti MP. no in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Sotgia F., Lee JK., Das K., Bedford M., Petrucci TC., Macioce P., Sargiacomo M., Bricarelli FD., Minetti C., Sudol M., Lisanti MP. no J. Biol. Chem. (0021-9258) 2000 Caveolin-3 directly interacts with the C-terminal tail of beta -dystroglycan. Identification of a central WW-like domain within caveolin family members. Caveolin-3 directly interacts with the C-terminal tail of beta -dystroglycan. Identification of a central WW-like domain within caveolin family members. J. Biol. Chem. (0021-9258) 2000 Sotgia F., Lee JK., Das K., Bedford M., Petrucci TC., Macioce P., Sargiacomo M., Bricarelli FD., Minetti C., Sudol M., Lisanti MP. no in vitro In vitro pull down pull down predetermined predetermined participant predetermined Sotgia F., Lee JK., Das K., Bedford M., Petrucci TC., Macioce P., Sargiacomo M., Bricarelli FD., Minetti C., Sudol M., Lisanti MP. no J. Biol. Chem. (0021-9258) 2000 cav3_rat Caveolin-3 Cav3 protein protein rat Rattus norvegicus (Rat) Rat MMTEEHTDLEARIIKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPEGTYSFDGVWRVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSNIKVVLRREG mint May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. May also regulate voltage-gated potassium channels A822A33EF9AA668F dag1_mouse Dystroglycan 1 Dag1 Dystrophin-associated glycoprotein 1 Dystroglycan protein protein mouse Mus musculus Mouse MSVDNWLLHPLWGQTFLLLLSVAVAQAHWPSEPSEAVRDWKNQLEASMHSVLSDFQEAVPTVVGIPDGTAVVGRSFRVSIPTDLIASSGEIIKVSAAGKEALPSWLHWDPHSHILEGLPLDTDKGVHYISVSAARLGANGSHVPQTSSVFSIEVYPEDHNEPQSVRAASSDPGEVVPSACAADEPVTVLTVILDADLTKMTPKQRIDLLNRMQSFSEVELHNMKLVPVVNNRLFDMSAFMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIRGVETPAREGAMSAQLGYPVVGWHIANKKPTLPKRLRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTLTIPGYVEPTAVITPPTTTTKKPRVSTPKPATPSTDSSTTTTRRPTKKPRTPRPVPRVTTKAPITRLETASPPTRIRTTTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDNEDTTTDKLKLTLKLREQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHKRPQGDKAPARFKARLAGDPAPVVNDIHKKIALVKKLAFAFGDRNCSSITLQNITRGSIVVEWTNNTLPLEPCPKEQIIGLSRRIADENGKPRPAFSNALEPDFKALSIAVTGSGSCRHLQFIPVAPPSPGSSAAPATEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSMPETTPLNQDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP 59C081EA86AB0AC1 cav3-dag1 4 5 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-431363: original sequence: 34-114 : EDIVKVDFEDVIAEPEGTYSFDGVWRVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIE Stoichiometry: 1.0 6 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction homomint mint cav3-dag1-1 3 5 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-431376: original sequence: 34-114 : EDIVKVDFEDVIAEPEGTYSFDGVWRVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIE Stoichiometry: 1.0 6 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction homomint mint cav3-dag1-2 2 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-431390: original sequence: 34-114 : EDIVKVDFEDVIAEPEGTYSFDGVWRVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIE Stoichiometry: 1.0 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association homomint mint cav3-dag1-3 1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-431403: original sequence: 34-114 : EDIVKVDFEDVIAEPEGTYSFDGVWRVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIE tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed Stoichiometry: 1.0 colocalization colocalization homomint mint