MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Identification of partners of TIF34, a component of the yeast eIF3 complex, required for cell proliferation and translation initiation. Identification of partners of TIF34, a component of the yeast eIF3 complex, required for cell proliferation and translation initiation. EMBO J. (0261-4189) 1997 Verlhac MH., Chen RH., Hanachi P., Hershey JW., Derynck R. in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Verlhac MH., Chen RH., Hanachi P., Hershey JW., Derynck R. EMBO J. (0261-4189) 1997 Identification of partners of TIF34, a component of the yeast eIF3 complex, required for cell proliferation and translation initiation. Identification of partners of TIF34, a component of the yeast eIF3 complex, required for cell proliferation and translation initiation. EMBO J. (0261-4189) 1997 Verlhac MH., Chen RH., Hanachi P., Hershey JW., Derynck R. in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Verlhac MH., Chen RH., Hanachi P., Hershey JW., Derynck R. no EMBO J. (0261-4189) 1997 eif3g_yeast Eukaryotic translation initiation factor 3 subunit G TIF35 YDR429C D9461.16 Eukaryotic translation initiation factor 3 RNA-binding subunit Translation initiation factor eIF3 p33 subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEVAPEEIIENADGSRSIITYKIEDGVKYKITQKVKEVKVLEKVHKSVAERKNWHKYGSEKGSPAGPSAVTARLGEEVELRLSRNWKQAEEERIQKEKASLTKTGLQCRLCGNDHMTMNCPFKTILSELSALEDPATNEGGVEAASEEKAGQVGGAGSIPGQYVPPSRRAGARDPSSDAYRDSRERDDMCTLKIMQVNENADENSLREELLFPFAPIPRVSVVRNKETGKSRGLAFVTFSSEEVAEQALRFLDGRGYMNLILRVEWSKPKVKE 340A5285F2C84E06 340A5285F2C84E06 eif3b_yeast Eukaryotic translation initiation factor 3 subunit B YOR361C PRT1 CDC63 Eukaryotic translation initiation factor 3 90 kDa subunit Translation initiation factor eIF3 p90 subunit Cell cycle regulation and translation initiation protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MKNFLPRTLKNIYELYFNNISVHSIVSRNTQLKRSKIIQMTTETFEDIKLEDIPVDDIDFSDLEEQYKVTEEFNFDQYIVVNGAPVIPSAKVPVLKKALTSLFSKAGKVVNMEFPIDEATGKTKGFLFVECGSMNDAKKIIKSFHGKRLDLKHRLFLYTMKDVERYNSDDFDTEFREPDMPTFVPSSSLKSWLMDDKVRDQFVLQDDVKTSVFWNSMFNEEDSLVESRENWSTNYVRFSPKGTYLFSYHQQGVTAWGGPNFDRLRRFYHPDVRNSSVSPNEKYLVTFSTEPIIVEEDNEFSPFTKKNEGHQLCIWDIASGLLMATFPVIKSPYLKWPLVRWSYNDKYCARMVGDSLIVHDATKNFMPLEAKALKPSGIRDFSFAPEGVKLQPFRNGDEPSVLLAYWTPETNNSACTATIAEVPRGRVLKTVNLVQVSNVTLHWQNQAEFLCFNVERHTKSGKTQFSNLQICRLTERDIPVEKVELKDSVFEFGWEPHGNRFVTISVHEVADMNYAIPANTIRFYAPETKEKTDVIKRWSLVKEIPKTFANTVSWSPAGRFVVVGALVGPNMRRSDLQFYDMDYPGEKNINDNNDVSASLKDVAHPTYSAATNITWDPSGRYVTAWSSSLKHKVEHGYKIFNIAGNLVKEDIIAGFKNFAWRPRPASILSNAERKKVRKNLREWSAQFEEQDAMEADTAMRDLILHQRELLKQWTEYREKIGQEMEKSMNFKIFDVQPEDASDDFTTIEEIVEEVLEETKEKVE F5E4E783408EE948 F5E4E783408EE948 eif3i_yeast Eukaryotic translation initiation factor 3 subunit I TIF34 YMR146C YM9375.16C Eukaryotic translation initiation factor 3 39 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MKAIKLTGHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYCVTGSADYSIKLWDVSNGQCVATWKSPVPVKRVEFSPCGNYFLAILDNVMKNPGSINIYEIERDSATHELTKVSEEPIHKIITHEGLDAATVAGWSTKGKYIIAGHKDGKISKYDVSNNYEYVDSIDLHEKSISDMQFSPDLTYFITSSRDTNSFLVDVSTLQVLKKYETDCPLNTAVITPLKEFIILGGGQEAKDVTTTSANEGKFEARFYHKIFEEEIGRVQGHFGPLNTVAISPQGTSYASGGEDGFIRLHHFEKSYFDFKYDVEKAAEAKEHMQEAN E6C0D0B275E87622 E6C0D0B275E87622 tif35-tif34-5 1 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1528834: original sequence: 1-152 : MSEVAPEEIIENADGSRSIITYKIEDGVKYKITQKVKEVKVLEKVHKSVAERKNWHKYGSEKGSPAGPSAVTARLGEEVELRLSRNWKQAEEERIQKEKASLTKTGLQCRLCGNDHMTMNCPFKTILSELSALEDPATNEGGVEAASEEKA tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association TIF35 and TIF34 take part to the eIF3 complex in Saccharomyces cerevisiae homomint mint prt1-tif34-27 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1528851: original sequence: 643-711 : AGNLVKEDIIAGFKNFAWRPRPASILSNAERKKVRKNLREWSAQFEEQDAMEADTAMRDLILHQRELL Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association PRT1 and TIF34 take part to the eIF3 complex in Saccharomyces cerevisiae homomint mint tif35-tif34-6 2 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-1528870: original sequence: 1-152 : MSEVAPEEIIENADGSRSIITYKIEDGVKYKITQKVKEVKVLEKVHKSVAERKNWHKYGSEKGSPAGPSAVTARLGEEVELRLSRNWKQAEEERIQKEKASLTKTGLQCRLCGNDHMTMNCPFKTILSELSALEDPATNEGGVEAASEEKA Stoichiometry: 1.0 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association TIF35 and TIF34 take part to the eIF3 complex in Saccharomyces cerevisiae homomint mint