MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Mitogen-activated protein kinases activate the serine/threonine kinases Mnk1 and Mnk2. Mitogen-activated protein kinases activate the serine/threonine kinases Mnk1 and Mnk2. EMBO J. (0261-4189) 1997 Waskiewicz AJ., Flynn A., Proud CG., Cooper JA. no in vitro In vitro pull down pull down predetermined predetermined participant predetermined Waskiewicz AJ., Flynn A., Proud CG., Cooper JA. no EMBO J. (0261-4189) 1997 Mitogen-activated protein kinases activate the serine/threonine kinases Mnk1 and Mnk2. Mitogen-activated protein kinases activate the serine/threonine kinases Mnk1 and Mnk2. EMBO J. (0261-4189) 1997 Waskiewicz AJ., Flynn A., Proud CG., Cooper JA. no in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Waskiewicz AJ., Flynn A., Proud CG., Cooper JA. no EMBO J. (0261-4189) 1997 Mitogen-activated protein kinases activate the serine/threonine kinases Mnk1 and Mnk2. Mitogen-activated protein kinases activate the serine/threonine kinases Mnk1 and Mnk2. EMBO J. (0261-4189) 1997 Waskiewicz AJ., Flynn A., Proud CG., Cooper JA. no in vivo in vivo imaging technique imaging technique microscopy predetermined predetermined participant predetermined Waskiewicz AJ., Flynn A., Proud CG., Cooper JA. no EMBO J. (0261-4189) 1997 Mitogen-activated protein kinases activate the serine/threonine kinases Mnk1 and Mnk2. Mitogen-activated protein kinases activate the serine/threonine kinases Mnk1 and Mnk2. EMBO J. (0261-4189) 1997 Waskiewicz AJ., Flynn A., Proud CG., Cooper JA. no in vitro In vitro experimental interac experimental interaction detection experimental interac predetermined predetermined participant predetermined Waskiewicz AJ., Flynn A., Proud CG., Cooper JA. no EMBO J. (0261-4189) 1997 Mitogen-activated protein kinases activate the serine/threonine kinases Mnk1 and Mnk2. Mitogen-activated protein kinases activate the serine/threonine kinases Mnk1 and Mnk2. EMBO J. (0261-4189) 1997 Waskiewicz AJ., Flynn A., Proud CG., Cooper JA. no yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Waskiewicz AJ., Flynn A., Proud CG., Cooper JA. no EMBO J. (0261-4189) 1997 mknk2_mouse MAP kinase-interacting serine/threonine-protein kinase 2 MAP kinase signal-integrating kinase 2 Mknk2 Mnk2 protein protein mouse Mus musculus Mouse MVQKRTAELQGFHRSFKGQNPFELAFSLDLAQHRDSDFSPQCEARPDMPSSQPIDIPDAKKRGRKKKRCRATDSFSGRFEDVYQLQEDVLGEGAHARVQTCVNLITNQEYAVKIIEKQLGHIRSRVFREVEMLYQCQGHRNVLELIEFFEEEDRFYLVFEKMRGGSILSHIHRRRHFNELEASVVVQDVASALDFLHNKGIAHRDLKPENILCEHPNQVSPVKICDFDLGSGIKLNGDCSPISTPELLTPCGSAEYMAPEVVEAFSEEASIYDKRCDLWSLGVILYILLSGYPPFVGHCGSDCGWDRGEACPACQNMLFESIQEGKYEFPDKDWSHISFAAKDLISKLLVRDAKQRLSAAQVLQHPWVQGCAPENTLPTPLVLQRNSCAKDLTSFAAEAIAMNRQLAQCEEDAGQDQPVVIRATSRCLQLSPPSQSKLAQRRQRASLSATPVVLVGDRA 5252C711AD99729A mk01_rat Mitogen-activated protein kinase 1 Mapk1 Erk2 Mapk Prkm1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 protein protein rat Rattus norvegicus (Rat) Rat MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS DIP protein P63086 original sequence version: 127 DIP protein P63086 original sequence version: 1(def) DIP protein P63086 original sequence version: 36 DIP protein P63086 original sequence version: 112 DIP protein P63086 original sequence version: 92 DIP protein P63086 original sequence version: 84 DIP protein P63086 original sequence version: 100 3BBCF22471EDBA0B mknk1_mouse MAP kinase-interacting serine/threonine-protein kinase 1 MAP kinase signal-integrating kinase 1 Mknk1 Mnk1 protein protein mouse Mus musculus Mouse MVSSQKLEKPIEMGSSEPLPIVDSDKRRKKKRKTRATDSLPGKFEDVYQLTSELLGEGAYAKVQGAVNLQSGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNRNILELIEFFEDDTRFYLVFEKLQGGSILAHIQKRKHFNEREASRVVRDVATALDFLHTKGIAHRDLKPENILCESPEKVSPVKICDFDLGSGVKLNNSCTPITTPELTTPCGSAEYMAPEVVEVFRDEATFYDKRCDLWSLGVVLYIMLSGYPPFVGHCGADCGWDRGEVCRMCQNKLFESIQEGKYEFPDKDWAHISNEAKDLISKLLVRDAKQRLSAAQVLQHPWVQGQAPERGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENELAEEQEALAEGLCSMKLSPPSKSRLARRRALAQAGRSRDANPCLTPAGL 7D59A1CBEE4DF68F mk11_mouse Mitogen-activated protein kinase 11 Mitogen-activated protein kinase p38 beta Mapk11 Prkm11 protein protein mouse Mus musculus Mouse MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSVFHGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPDDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPLEPSQLPGTHEIEQ 75C16E9972508220 mk03_mouse Mitogen-activated protein kinase 3 Mapk3 Extracellular signal-regulated kinase 1 Insulin-stimulated MAP2 kinase p44-ERK1 ERT2 MAP kinase isoform p44 Microtubule-associated protein 2 kinase MNK1 Erk1 Prkm3 protein protein mouse Mus musculus Mouse MAAAAAAPGGGGGEPRGTAGVVPVVPGEVEVVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERLKELIFQETARFQPGAPEGP DIP protein Q63844 original sequence version: 128 49C14A95B627237F mapk1-mknk2-23 1 7 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 6 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction homomint mint mapk1-mknk1-2 1 8 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 7 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction mint mapk11-mknk1 1 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction NFA mint mapk3-mknk1 3 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation mint mapk3-mknk2 3 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation homomint mint mapk11-mknk2 4 9 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 6 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation homomint mint mapk1-mknk2-24 2 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association homomint mint mapk1-mknk1-3 2 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association mint mapk11-mknk2-1 2 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association homomint mint mapk11-mknk1-1 5 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association NFA mint