MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it BCL-2, BCL-X(L) sequester BH3 domain-only molecules preventing BAX- and BAK-mediated mitochondrial apoptosis. BCL-2, BCL-X(L) sequester BH3 domain-only molecules preventing BAX- and BAK-mediated mitochondrial apoptosis. Mol. Cell (1097-2765) 2001 Cheng EH., Wei MC., Weiler S., Flavell RA., Mak TW., Lindsten T., Korsmeyer SJ. Virus - Publications including interactions involving viral proteins no in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Cheng EH., Wei MC., Weiler S., Flavell RA., Mak TW., Lindsten T., Korsmeyer SJ. Virus - Publications including interactions involving viral proteins no Mol. Cell (1097-2765) 2001 bcl2_mouse Apoptosis regulator Bcl-2 Bcl2 Bcl-2 protein protein mouse Mus musculus Mouse MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10417 original sequence version: 71 DIP protein P10417 original sequence version: 126 80FDCFE78C735092 b2cl1_human Bcl-2-like protein 1 BCL2L1 BCL2L BCLX Apoptosis regulator Bcl-X protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK E09D3CDD851AE9BE bid_mouse BH3-interacting domain death agonist p22 BID Bid protein protein mouse Mus musculus Mouse MDSEVSNGSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD DIP protein P70444 original sequence version: 65 DIP protein P70444 original sequence version: 69 DIP protein P70444 original sequence version: 137 52F412714FB867F3 bad_human Bcl2-associated agonist of cell death Bcl-2-binding component 6 Bcl-2-like protein 8 BAD BBC6 BCL2L8 Bcl-xL/Bcl-2-associated death promoter Bcl2 antagonist of cell death protein protein human Homo sapiens Human MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ DIP protein Q92934 original sequence version: 66 DIP protein Q92934 original sequence version: 121 69FD8D27DDEE3241 bad-bcl2l1-5 1 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-590755: original sequence: 142-165 : RQSSSWTRVFQSWWDRNLGRGSS Stoichiometry: 1.0 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association homomint mint bid-bcl2l1-11 1 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association Modification required: cleavage of BID (tBID) homomint mint bid-bcl2-12 1 2 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association Modification required: Cleavage of BID (tBID) mint