MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Binding of 14-3-3beta regulates the kinase activity and subcellular localization of testicular protein kinase 1. Binding of 14-3-3beta regulates the kinase activity and subcellular localization of testicular protein kinase 1. J. Biol. Chem. (0021-9258) 2001 rapid curation Toshima JY., Toshima J., Watanabe T., Mizuno K. no 30-Sept-2013: Contacted by IntAct-Help. partial coverage rapid curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Toshima JY., Toshima J., Watanabe T., Mizuno K. no Accepted 2013-SEP-26 by MARTA 30-Sept-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2001 partial coverage rapid curation rapid curation Binding of 14-3-3beta regulates the kinase activity and subcellular localization of testicular protein kinase 1. Binding of 14-3-3beta regulates the kinase activity and subcellular localization of testicular protein kinase 1. J. Biol. Chem. (0021-9258) 2001 rapid curation Toshima JY., Toshima J., Watanabe T., Mizuno K. no 30-Sept-2013: Contacted by IntAct-Help. partial coverage rapid curation unknown Unknown pull down pull down predetermined predetermined participant predetermined Toshima JY., Toshima J., Watanabe T., Mizuno K. no Accepted 2013-SEP-26 by MARTA 30-Sept-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2001 partial coverage rapid curation rapid curation Binding of 14-3-3beta regulates the kinase activity and subcellular localization of testicular protein kinase 1. Binding of 14-3-3beta regulates the kinase activity and subcellular localization of testicular protein kinase 1. J. Biol. Chem. (0021-9258) 2001 rapid curation Toshima JY., Toshima J., Watanabe T., Mizuno K. no 30-Sept-2013: Contacted by IntAct-Help. partial coverage rapid curation in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Toshima JY., Toshima J., Watanabe T., Mizuno K. no Accepted 2013-SEP-26 by MARTA 30-Sept-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2001 partial coverage rapid curation rapid curation Binding of 14-3-3beta regulates the kinase activity and subcellular localization of testicular protein kinase 1. Binding of 14-3-3beta regulates the kinase activity and subcellular localization of testicular protein kinase 1. J. Biol. Chem. (0021-9258) 2001 rapid curation Toshima JY., Toshima J., Watanabe T., Mizuno K. no 30-Sept-2013: Contacted by IntAct-Help. partial coverage rapid curation in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Toshima JY., Toshima J., Watanabe T., Mizuno K. no Accepted 2013-SEP-26 by MARTA 30-Sept-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2001 partial coverage rapid curation rapid curation Binding of 14-3-3beta regulates the kinase activity and subcellular localization of testicular protein kinase 1. Binding of 14-3-3beta regulates the kinase activity and subcellular localization of testicular protein kinase 1. J. Biol. Chem. (0021-9258) 2001 rapid curation Toshima JY., Toshima J., Watanabe T., Mizuno K. no 30-Sept-2013: Contacted by IntAct-Help. partial coverage rapid curation in vivo in vivo imaging technique imaging technique microscopy predetermined predetermined participant predetermined Toshima JY., Toshima J., Watanabe T., Mizuno K. no Accepted 2013-SEP-26 by MARTA 30-Sept-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2001 partial coverage rapid curation rapid curation tesk1_rat Dual specificity testis-specific protein kinase 1 Tesk1 Testicular protein kinase 1 protein protein rat Rattus norvegicus (Rat) Rat MAGERPPLRGPGPGETPVEGPGGAGGGPGRGRPSSYRALRSAVSSLARVDDFDCAEKIGAGFFSEVYKVRHRQSGQVMVLKMNKLPSNRSNTLREVQLMNRLRHPNILRFMGVCVHQGQLHALTEYMNGGTLEQLLSSPEPLSWPVRLHLALDIAQGLRYLHAKGVFHRDLTSKNCLVRREDGGFTAVVGDFGLAEKIPVYREGARKEPLAVVGSPYWMAPEVLRGELYDEKADVFAFGIVLCELIARVPADPDYLPRTEDFGLDVPAFRTLVGNDCPLPFLLLAIHCCSMEPSARAPFTEITQHLEQILEQLPEPTPLAKMPLAKAPLTYNQGSVPRGGPSATLPRSDPRLSRSRSDLFLPPSPESPPSWGDNLTRVNPFSLREDLRGGKIKLLDTPCKPATPLPLVPPSPLTSTQLPLVASPESLVQPETPVRRCRSLPSSPELPRRMETALPGPGPSPVGPSTEERMDCEGSSPEPEPPGPAPQLPLAVATDNFISTCSSASQPWSARPGPSLNNNPPAVVVNSPQGWAREPWNRAQHSLPRAAALERTEPSPPPSAPREQEEGLPCPGCCLSPFSFGFLSMCPRPTPAVARYRNLNCEAGSLLCHRGHHAKPPTPSLQLPGARS mint Dual specificity protein kinase activity catalyzing autophosphorylation and phosphorylation of exogenous substrates on both serine/threonine and tyrosine residues. Probably plays a central role at and after the meiotic phase of spermatogenesis F05F67FBD934B9AD 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN DIP protein P31946 original sequence version: 171 DIP protein P31946 original sequence version: 97 DIP protein P31946 original sequence version: 119 DIP protein P31946 original sequence version: 122 DIP protein P31946 original sequence version: 180 6BE1A9BF97468017 tesk1_human Dual specificity testis-specific protein kinase 1 TESK1 Testicular protein kinase 1 protein protein human Homo sapiens Human MAGERPPLRGPGPGPGEVPGEGPPGPGGTGGGPGRGRPSSYRALRSAVSSLARVDDFHCAEKIGAGFFSEVYKVRHRQSGQVMVLKMNKLPSNRGNTLREVQLMNRLRHPNILRFMGVCVHQGQLHALTEYMNGGTLEQLLSSPEPLSWPVRLHLALDIARGLRYLHSKGVFHRDLTSKNCLVRREDRGFTAVVGDFGLAEKIPVYREGARKEPLAVVGSPYWMAPEVLRGELYDEKADVFAFGIVLCELIARVPADPDYLPRTEDFGLDVPAFRTLVGDDCPLPFLLLAIHCCNLEPSTRAPFTEITQHLEWILEQLPEPAPLTRTALTHNQGSVARGGPSATLPRPDPRLSRSRSDLFLPPSPESPPNWGDNLTRVNPFSLREDLRGGKIKLLDTPSKPVLPLVPPSPFPSTQLPLVTTPETLVQPGTPARRCRSLPSSPELPRRMETALPGPGPPAVGPSAEEKMECEGSSPEPEPPGPAPQLPLAVATDNFISTCSSASQPWSPRSGPVLNNNPPAVVVNSPQGWAGEPWNRAQHSLPRAAALERTEPSPPPSAPREPDEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLNCEAGSLLCHRGHHAKPPTPSLQLPGARS 32F78E5E6AEDB0E5 ywhab-tesk1 1 TESK1 8 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 1433B 7 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction mint ywhab-tesk1-1 4 1433B 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 TESK1 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association mint ywhab-tesk1-2 3 1433B 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 TESK1 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association mint tesk1-ywhab 5 1433B 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 TESK1 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed Stoichiometry: 1.0 colocalization colocalization mint tesk1-ywhab-1 2 TESK1_RAT 6 unspecified role unspecified role unspecified role unspecified role 1433B_HUMAN 7 unspecified role unspecified role unspecified role unspecified role association association homomint domino mint