MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The survival of motor neurons (SMN) protein interacts with the snoRNP proteins fibrillarin and GAR1. The survival of motor neurons (SMN) protein interacts with the snoRNP proteins fibrillarin and GAR1. Curr. Biol. (0960-9822) 2001 Pellizzoni L., Baccon J., Charroux B., Dreyfuss G. no in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Pellizzoni L., Baccon J., Charroux B., Dreyfuss G. no Curr. Biol. (0960-9822) 2001 The survival of motor neurons (SMN) protein interacts with the snoRNP proteins fibrillarin and GAR1. The survival of motor neurons (SMN) protein interacts with the snoRNP proteins fibrillarin and GAR1. Curr. Biol. (0960-9822) 2001 Pellizzoni L., Baccon J., Charroux B., Dreyfuss G. no in vitro In vitro pull down pull down predetermined predetermined participant predetermined Pellizzoni L., Baccon J., Charroux B., Dreyfuss G. no Curr. Biol. (0960-9822) 2001 gar1_human H/ACA ribonucleoprotein complex subunit 1 GAR1 NOLA1 snoRNP protein GAR1 Nucleolar protein family A member 1 protein protein human Homo sapiens Human MSFRGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGGGFRGRGH 48CF04B78836EF91 fbrl_human rRNA 2'-O-methyltransferase fibrillarin FBL FIB1 FLRN Histone-glutamine methyltransferase 34 kDa nucleolar scleroderma antigen U6 snRNA 2'-O-methyltransferase fibrillarin protein protein human Homo sapiens Human MKPGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN DIP protein P22087 original sequence version: 84 DIP protein P22087 original sequence version: 154 2123F41E01EC557A smn_human Survival motor neuron protein SMN1 SMN SMNT SMN2 SMNC Component of gems 1 Gemin-1 protein protein human Homo sapiens Human MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN DIP protein Q16637 original sequence version: 129 DIP protein Q16637-1 original sequence version: 185 DIP protein Q16637 original sequence version: 182 DIP protein Q16637 original sequence version: 149 8A9A2A94192DCB9B smn1-gar1 2 NOLA1 3 unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain RGG range MINT-585134: original sequence: 4-57 : RGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRG Stoichiometry: 1.0 SMN 5 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Y/G range MINT-585128: original sequence: 240-267 : PPIIPPPPPICPDSLDDADALGSMLIS Stoichiometry: 1.0 direct interaction direct interaction homomint mint smn1-fbl 2 SMN 5 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Y/G range MINT-585160: original sequence: 240-267 : PPIIPPPPPICPDSLDDADALGSMLIS Stoichiometry: 1.0 FBRL 4 unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain RGG range MINT-585166: original sequence: 8-77 : RGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRGRGG Stoichiometry: 1.0 direct interaction direct interaction homomint mint smn1-gar1-1 1 SMN 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Y/G range MINT-585145: original sequence: 240-267 : PPIIPPPPPICPDSLDDADALGSMLIS Stoichiometry: 1.0 NOLA1 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain RGG range MINT-585151: original sequence: 4-57 : RGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRG Stoichiometry: 1.0 physical association physical association homomint mint smn1-fbl-1 1 FBRL 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain RGG range MINT-585181: original sequence: 8-77 : RGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRGGGGFHSGGNRGRGRGG Stoichiometry: 1.0 SMN 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Y/G range MINT-585175: original sequence: 240-267 : PPIIPPPPPICPDSLDDADALGSMLIS Stoichiometry: 1.0 physical association physical association homomint mint