MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The chaperone protein 14-3-3eta interacts with the nicotinic acetylcholine receptor alpha 4 subunit. Evidence for a dynamic role in subunit stabilization. The chaperone protein 14-3-3eta interacts with the nicotinic acetylcholine receptor alpha 4 subunit. Evidence for a dynamic role in subunit stabilization. J. Biol. Chem. (0021-9258) 2001 rapid curation Jeanclos EM., Lin L., Treuil MW., Rao J., DeCoster MA., Anand R. 22-Nov-2013: Contacted by IntAct-Help. partial coverage rapid curation in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Jeanclos EM., Lin L., Treuil MW., Rao J., DeCoster MA., Anand R. Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2001 partial coverage rapid curation rapid curation The chaperone protein 14-3-3eta interacts with the nicotinic acetylcholine receptor alpha 4 subunit. Evidence for a dynamic role in subunit stabilization. The chaperone protein 14-3-3eta interacts with the nicotinic acetylcholine receptor alpha 4 subunit. Evidence for a dynamic role in subunit stabilization. J. Biol. Chem. (0021-9258) 2001 rapid curation Jeanclos EM., Lin L., Treuil MW., Rao J., DeCoster MA., Anand R. 22-Nov-2013: Contacted by IntAct-Help. partial coverage rapid curation in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Jeanclos EM., Lin L., Treuil MW., Rao J., DeCoster MA., Anand R. no Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2001 partial coverage rapid curation rapid curation The chaperone protein 14-3-3eta interacts with the nicotinic acetylcholine receptor alpha 4 subunit. Evidence for a dynamic role in subunit stabilization. The chaperone protein 14-3-3eta interacts with the nicotinic acetylcholine receptor alpha 4 subunit. Evidence for a dynamic role in subunit stabilization. J. Biol. Chem. (0021-9258) 2001 rapid curation Jeanclos EM., Lin L., Treuil MW., Rao J., DeCoster MA., Anand R. 22-Nov-2013: Contacted by IntAct-Help. partial coverage rapid curation in vivo in vivo imaging technique imaging technique microscopy predetermined predetermined participant predetermined Jeanclos EM., Lin L., Treuil MW., Rao J., DeCoster MA., Anand R. no Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2001 partial coverage rapid curation rapid curation The chaperone protein 14-3-3eta interacts with the nicotinic acetylcholine receptor alpha 4 subunit. Evidence for a dynamic role in subunit stabilization. The chaperone protein 14-3-3eta interacts with the nicotinic acetylcholine receptor alpha 4 subunit. Evidence for a dynamic role in subunit stabilization. J. Biol. Chem. (0021-9258) 2001 rapid curation Jeanclos EM., Lin L., Treuil MW., Rao J., DeCoster MA., Anand R. 22-Nov-2013: Contacted by IntAct-Help. partial coverage rapid curation unknown Unknown pull down pull down predetermined predetermined participant predetermined Jeanclos EM., Lin L., Treuil MW., Rao J., DeCoster MA., Anand R. no Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2001 partial coverage rapid curation rapid curation 1433f_mouse 14-3-3 protein eta Ywhah protein protein mouse Mus musculus Mouse MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN C12F62B4ABA76DA3 1433f_human 14-3-3 protein eta YWHAH YWHA1 Protein AS1 protein protein human Homo sapiens Human MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN DIP protein Q04917 original sequence version: 166 DIP protein Q04917 original sequence version: 168 DIP protein Q04917 original sequence version: 175 D70FBC100C45D6E5 acha4_rat Neuronal acetylcholine receptor subunit alpha-4 Chrna4 Acra4 protein protein rat Rattus norvegicus (Rat) Rat MANSGTGAPPPLLLLPLLLLLGTGLLPASSHIETRAHAEERLLKRLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVSMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPSPTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPAWVRRVFLDIVPRLLFMKRPSVVKDNCRRLIESMHKMANAPRFWPEPVGEPGILSDICNQGLSPAPTFCNPTDTAVETQPTCRSPPLEVPDLKTSEVEKASPCPSPGSCPPPKSSSGAPMLIKARSLSVQHVPSSQEAAEDGIRCRSRSIQYCVSQDGAASLADSKPTSSPTSLKARPSQLPVSDQASPCKCTCKEPSPVSPVTVLKAGGTKAPPQHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFLPPWLAAC mint After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane 1DFFC9E1378E5417 chrna4-ywhah 1 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain CYTOPLASMIC REGION range MINT-577314: original sequence: 413-450 : CNPTDTAVETQPTCRSPPLEVPDLKTSEVEKASPCPS tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-577317: original sequence: 441-441 : LEVPDLKTSEVEKASPCPSP Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association 14-3-3s eta interact with AChR alpha 4 in a phosphorylation dependent manner and significantly increase the steady state levels of the alpha 4 subunits alone and alpha4beta2 AChRs mint chrna4-ywhah-1 2 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-577337: original sequence: 441-441 : LEVPDLKTSEVEKASPCPSP binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain CYTOPLASMIC REGION range MINT-577334: original sequence: 413-450 : CNPTDTAVETQPTCRSPPLEVPDLKTSEVEKASPCPS Stoichiometry: 1.0 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association 14-3-3s eta interact with AChR alpha 4 in a phosphorylation dependent manner and significantly increase the steady state levels of the alpha 4 subunits alone and alpha4beta2 AChRs mint ywhah-chrna4 2 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-577375: original sequence: 441-441 : LEVPDLKTSEVEKASPCPSP binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain CYTOPLASMIC REGION range MINT-577372: original sequence: 413-450 : CNPTDTAVETQPTCRSPPLEVPDLKTSEVEKASPCPS Stoichiometry: 1.0 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association 14-3-3s eta interact with AChR alpha 4 in a phosphorylation dependent manner and significantly increase the steady state levels of the alpha 4 subunits alone and alpha4beta2 AChRs mint chrna4-ywhah-2 3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-577358: original sequence: 441-441 : LEVPDLKTSEVEKASPCPSP binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain CYTOPLASMIC REGION range MINT-577355: original sequence: 413-450 : CNPTDTAVETQPTCRSPPLEVPDLKTSEVEKASPCPS Stoichiometry: 1.0 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 colocalization colocalization 14-3-3s eta interact with AChR alpha 4 in a phosphorylation dependent manner and significantly increase the steady state levels of the alpha 4 subunits alone and alpha4beta2 AChRs mint chrna4-ywhah-3 4 ACHA4_RAT 7 unspecified role unspecified role unspecified role unspecified role 1433F_HUMAN 6 unspecified role unspecified role unspecified role unspecified role association association homomint domino mint