MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Modulation of the G protein regulator phosducin by Ca2+/calmodulin-dependent protein kinase II phosphorylation and 14-3-3 protein binding. Modulation of the G protein regulator phosducin by Ca2+/calmodulin-dependent protein kinase II phosphorylation and 14-3-3 protein binding. J. Biol. Chem. (0021-9258) 2001 rapid curation Thulin CD., Savage JR., McLaughlin JN., Truscott SM., Old WM., Ahn NG., Resing KA., Hamm HE., Bitensky MW., Willardson BM. no 22-Nov-2013: Contacted by IntAct-Help. partial coverage rapid curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Thulin CD., Savage JR., McLaughlin JN., Truscott SM., Old WM., Ahn NG., Resing KA., Hamm HE., Bitensky MW., Willardson BM. no Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2001 partial coverage rapid curation rapid curation Modulation of the G protein regulator phosducin by Ca2+/calmodulin-dependent protein kinase II phosphorylation and 14-3-3 protein binding. Modulation of the G protein regulator phosducin by Ca2+/calmodulin-dependent protein kinase II phosphorylation and 14-3-3 protein binding. J. Biol. Chem. (0021-9258) 2001 rapid curation Thulin CD., Savage JR., McLaughlin JN., Truscott SM., Old WM., Ahn NG., Resing KA., Hamm HE., Bitensky MW., Willardson BM. no 22-Nov-2013: Contacted by IntAct-Help. partial coverage rapid curation unknown Unknown pull down pull down predetermined predetermined participant predetermined Thulin CD., Savage JR., McLaughlin JN., Truscott SM., Old WM., Ahn NG., Resing KA., Hamm HE., Bitensky MW., Willardson BM. no Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2001 partial coverage rapid curation rapid curation 1433e_bovin 14-3-3 protein epsilon YWHAE protein protein bovin Bos taurus (Bovine) Bovine MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner mint 07817CCBD1F75B26 1433z_rat 14-3-3 protein zeta/delta Ywhaz Msfs1 Protein kinase C inhibitor protein 1 Mitochondrial import stimulation factor S1 subunit protein protein rat Rattus norvegicus (Rat) Rat MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN DIP protein P63102 original sequence version: 65 2164DF3793B45B7A phos_rat Phosducin Pdc Rpr1 33 kDa phototransducing protein Rod photoreceptor 1 Protein MEKA protein protein rat Rattus norvegicus (Rat) Rat MEEAASQSLEEDFEGQATHTGPKGVINDWRKFKLESEDGDSIPPSKKEILRQMSSPQSRDDKDSKERMSRKMSIQEYELIHQDKEDEGCLRKYRRQCMQDMHQKLSFGPRYGFVYELETGEQFLETIEKEQKVTTIVVNIYEDGVRGCDALNSSLECLAAEYPMVKFCKIRASNTGAGDRFSSDVLPTLLVYKGGELISNFISVAEQFAEDFFAADVESFLNEYGLLPEREIHDLGQTNTEDEDIE DIP protein P20942 original sequence version: 90 mint May participate in the regulation of visual phototransduction or in the integration of photoreceptor metabolism 3C48ABCB4E5E3D04 pdc-ywhaz 1 5 unspecified role unspecified role bait bait purified purified phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-576778: original sequence: 106-106 : QCMQDMHQKLSFGPRYGFVY phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-576776: original sequence: 73-73 : DSKERMSRKMSIQEYELIHQ phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-576772: original sequence: 36-36 : INDWRKFKLESEDGDSIPPS phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-576770: original sequence: 6-6 : MEEAASQSLEEDFEG binding site binding region binding-associated region binding region alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain MOTIF:RQMSSP MOTIF:RKMSIQ range MINT-576766: original sequence: 51-75 : RQMSSPQSRDDKDSKERMSRKMSI phosphoserine o-phospho-serine opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain range MINT-576774: original sequence: 54-54 : PSKKEILRQMSSPQSRDDKD Stoichiometry: 1.0 4 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction 14-3-3 binds phosphorylated Pd and and sequester Dp from G protein subunits beta and gamma. mint pdc-ywhae-3 2 1433E_BOVIN 3 unspecified role unspecified role unspecified role unspecified role PHOS_RAT 5 unspecified role unspecified role unspecified role unspecified role association association homomint domino mint pdc-ywhae-4 2 1433E_BOVIN 3 unspecified role unspecified role unspecified role unspecified role PHOS_RAT 5 unspecified role unspecified role unspecified role unspecified role association association homomint domino mint