MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Role of histone H3 lysine 9 methylation in epigenetic control of heterochromatin assembly. Role of histone H3 lysine 9 methylation in epigenetic control of heterochromatin assembly. Science (0036-8075) 2001 Nakayama J., Rice JC., Strahl BD., Allis CD., Grewal SI. no in vivo in vivo experimental interac experimental interaction detection experimental interac nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Nakayama J., Rice JC., Strahl BD., Allis CD., Grewal SI. no Science (0036-8075) 2001 h31_schpo Histone H3.1/H3.2 hht1 hht2 SPAC1834.04 SPBC8D2.04 pi060 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MARTKQTARKSTGGKAPRKQLASKAARKAAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQEAVEAYLVSLFEDTNLCAIHGKRVTIQPKDMQLARRLRGERS 346976EDD06C2284 clr4_schpo Histone-lysine N-methyltransferase, H3 lysine-9 specific clr4 SPBC428.08c kmt1 Histone H3-K9 methyltransferase Cryptic loci regulator 4 Lysine N-methyltransferase 1 Protein lysine methyltransferase clr4 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSPKQEEYEVERIVDEKLDRNGAVKLYRIRWLNYSSRSDTWEPPENLSGCSAVLAEWKRRKRRLKGSNSDSDSPHHASNPHPNSRQKHQHQTSKSVPRSQRFSRELNVKKENKKVFSSQTTKRQSRKQSTALTTNDTSIILDDSLHTNSKKLGKTRNEVKEESQKRELVSNSIKEATSPKTSSILTKPRNPSKLDSYTHLSFYEKRELFRKKLREIEGPEVTLVNEVDDEPCPSLDFQFISQYRLTQGVIPPDPNFQSGCNCSSLGGCDLNNPSRCECLDDLDEPTHFAYDAQGRVRADTGAVIYECNSFCSCSMECPNRVVQRGRTLPLEIFKTKEKGWGVRSLRFAPAGTFITCYLGEVITSAEAAKRDKNYDDDGITYLFDLDMFDDASEYTVDAQNYGDVSRFFNHSCSPNIAIYSAVRNHGFRTIYDLAFFAIKDIQPLEELTFDYAGAKDFSPVQSQKSQQNRISKLRRQCKCGSANCRGWLFG 53C3EC87BCBA51FF 53C3EC87BCBA51FF clr4-hht1 1 3 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 methylation methylation reaction methylation 3'-methyl-L-histidine@9 mint