MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Drosophila melanogaster casein kinase II interacts with and phosphorylates the basic helix-loop-helix proteins m5, m7, and m8 derived from the Enhancer of split complex. Drosophila melanogaster casein kinase II interacts with and phosphorylates the basic helix-loop-helix proteins m5, m7, and m8 derived from the Enhancer of split complex. J. Biol. Chem. (0021-9258) 2001 Trott RL., Kalive M., Paroush Z., Bidwai AP. rapid curation in vitro In vitro protein kinase assay protein kinase assay nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Trott RL., Kalive M., Paroush Z., Bidwai AP. J. Biol. Chem. (0021-9258) 2001 rapid curation Drosophila melanogaster casein kinase II interacts with and phosphorylates the basic helix-loop-helix proteins m5, m7, and m8 derived from the Enhancer of split complex. Drosophila melanogaster casein kinase II interacts with and phosphorylates the basic helix-loop-helix proteins m5, m7, and m8 derived from the Enhancer of split complex. J. Biol. Chem. (0021-9258) 2001 Trott RL., Kalive M., Paroush Z., Bidwai AP. rapid curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Trott RL., Kalive M., Paroush Z., Bidwai AP. J. Biol. Chem. (0021-9258) 2001 rapid curation Drosophila melanogaster casein kinase II interacts with and phosphorylates the basic helix-loop-helix proteins m5, m7, and m8 derived from the Enhancer of split complex. Drosophila melanogaster casein kinase II interacts with and phosphorylates the basic helix-loop-helix proteins m5, m7, and m8 derived from the Enhancer of split complex. J. Biol. Chem. (0021-9258) 2001 Trott RL., Kalive M., Paroush Z., Bidwai AP. rapid curation in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Trott RL., Kalive M., Paroush Z., Bidwai AP. J. Biol. Chem. (0021-9258) 2001 rapid curation esm7_drome Enhancer of split m7 protein E(spl)m7-HLH HLHm7 CG8361 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MATKYEMSKTYQYRKVMKPLLERKRRARINKCLDELKDLMAECVAQTGDAKFEKADILEVTVQHLRKLKESKKHVPANPEQSFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQLEQPMEQPQAVNTPLSIVCGSSSSSSTYSSASSCSSISPVSSGYASDNESLLQISSPGQVWRPW 9330530963CDCE15 esm8_drome Enhancer of split m8 protein E(spl)m8-HLH E(spl) m8 CG8365 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEYTTKTQIYQKVKKPMLERQRRARMNKCLDNLKTLVAELRGDDGILRMDKAEMLESAVIFMRQQKTPKKVAQEEQSLPLDSFKNGYMNAVNEVSRVMASTPGMSVDLGKSVMTHLGRVYKNLQQFHEAQSAADFIQNSMDCSSMDKAPLSPASSGYHSDCDSPAPSPQPMQQPLWRPW 017B139DE0C328B4 csk2a_drome Casein kinase II subunit alpha CkIIalpha Cask-II-a CG17520 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTLPSAARVYTDVNAHKPDEYWDYENYVVDWGNQDDYQLVRKLGRGKYSEVFEAINITTTEKCVVKILKPVKKKKIKREIKILENLRGGTNIITLLAVVKDPVSRTPALIFEHVNNTDFKQLYQTLTDYEIRYYLFELLKALDYCHSMGIMHRDVKPHNVMIDHENRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEELYAYLDKYNIDLDPRFHDILQRHSRKRWERFVHSDNQHLVSPEALDFLDKLLRYDHVDRLTAREAMAHPYFLPIVNGQMNPNNQQ DIP protein P08181 original sequence version: 136 69D15F124427B21E esm5_drome Enhancer of split m5 protein E(spl)m5-HLH HLHm5 CG6096 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAPQSNNSTTFVSKTQHYLKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAILRMDKAEMLEAALVFMRKQVVKQQAPVSPLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEFQRMLQADQVQTSVTTSTPRPLSPASSGYHSDNEDSQSAASPKPVEETMWRPW 19363D0F6043C84F ckiialpha-e_spl_ 2 5 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 6 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction CKII binds and phosphorylaes m8 on Ser159. Changing Ser into Ala binding is decresed. By changing Ser into Asp, binding is abolished. mint ckiialpha-hlhm7 3 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association mint ckiialpha-e_spl_-1 3 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association CKII binds and phosphorylaes m8 on Ser159. Changing Ser into Ala binding is decresed. By changing Ser into Asp, binding is abolished. mint ckiialpha-hlhm5 3 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association mint ckiialpha-e_spl_-2 1 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme enzyme unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation mint