MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it TAZ: a novel transcriptional co-activator regulated by interactions with 14-3-3 and PDZ domain proteins. TAZ: a novel transcriptional co-activator regulated by interactions with 14-3-3 and PDZ domain proteins. EMBO J. (0261-4189) 2000 rapid curation Kanai F., Marignani PA., Sarbassova D., Yagi R., Hall RA., Donowitz M., Hisaminato A., Fujiwara T., Ito Y., Cantley LC., Yaffe MB. no 22-Nov-2013: Contacted by IntAct-Help. partial coverage rapid curation in vivo in vivo imaging technique imaging technique microscopy predetermined predetermined participant predetermined Kanai F., Marignani PA., Sarbassova D., Yagi R., Hall RA., Donowitz M., Hisaminato A., Fujiwara T., Ito Y., Cantley LC., Yaffe MB. no Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. EMBO J. (0261-4189) 2000 partial coverage rapid curation rapid curation TAZ: a novel transcriptional co-activator regulated by interactions with 14-3-3 and PDZ domain proteins. TAZ: a novel transcriptional co-activator regulated by interactions with 14-3-3 and PDZ domain proteins. EMBO J. (0261-4189) 2000 rapid curation Kanai F., Marignani PA., Sarbassova D., Yagi R., Hall RA., Donowitz M., Hisaminato A., Fujiwara T., Ito Y., Cantley LC., Yaffe MB. no 22-Nov-2013: Contacted by IntAct-Help. partial coverage rapid curation in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Kanai F., Marignani PA., Sarbassova D., Yagi R., Hall RA., Donowitz M., Hisaminato A., Fujiwara T., Ito Y., Cantley LC., Yaffe MB. no Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. EMBO J. (0261-4189) 2000 partial coverage rapid curation rapid curation TAZ: a novel transcriptional co-activator regulated by interactions with 14-3-3 and PDZ domain proteins. TAZ: a novel transcriptional co-activator regulated by interactions with 14-3-3 and PDZ domain proteins. EMBO J. (0261-4189) 2000 rapid curation Kanai F., Marignani PA., Sarbassova D., Yagi R., Hall RA., Donowitz M., Hisaminato A., Fujiwara T., Ito Y., Cantley LC., Yaffe MB. no 22-Nov-2013: Contacted by IntAct-Help. partial coverage rapid curation in vivo in vivo beta lactamase beta lactamase complementation beta lactamase nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kanai F., Marignani PA., Sarbassova D., Yagi R., Hall RA., Donowitz M., Hisaminato A., Fujiwara T., Ito Y., Cantley LC., Yaffe MB. no Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. EMBO J. (0261-4189) 2000 partial coverage rapid curation rapid curation TAZ: a novel transcriptional co-activator regulated by interactions with 14-3-3 and PDZ domain proteins. TAZ: a novel transcriptional co-activator regulated by interactions with 14-3-3 and PDZ domain proteins. EMBO J. (0261-4189) 2000 rapid curation Kanai F., Marignani PA., Sarbassova D., Yagi R., Hall RA., Donowitz M., Hisaminato A., Fujiwara T., Ito Y., Cantley LC., Yaffe MB. no 22-Nov-2013: Contacted by IntAct-Help. partial coverage rapid curation in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Kanai F., Marignani PA., Sarbassova D., Yagi R., Hall RA., Donowitz M., Hisaminato A., Fujiwara T., Ito Y., Cantley LC., Yaffe MB. no Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. EMBO J. (0261-4189) 2000 partial coverage rapid curation rapid curation TAZ: a novel transcriptional co-activator regulated by interactions with 14-3-3 and PDZ domain proteins. TAZ: a novel transcriptional co-activator regulated by interactions with 14-3-3 and PDZ domain proteins. EMBO J. (0261-4189) 2000 rapid curation Kanai F., Marignani PA., Sarbassova D., Yagi R., Hall RA., Donowitz M., Hisaminato A., Fujiwara T., Ito Y., Cantley LC., Yaffe MB. no 22-Nov-2013: Contacted by IntAct-Help. partial coverage rapid curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Kanai F., Marignani PA., Sarbassova D., Yagi R., Hall RA., Donowitz M., Hisaminato A., Fujiwara T., Ito Y., Cantley LC., Yaffe MB. no Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. EMBO J. (0261-4189) 2000 partial coverage rapid curation rapid curation TAZ: a novel transcriptional co-activator regulated by interactions with 14-3-3 and PDZ domain proteins. TAZ: a novel transcriptional co-activator regulated by interactions with 14-3-3 and PDZ domain proteins. EMBO J. (0261-4189) 2000 rapid curation Kanai F., Marignani PA., Sarbassova D., Yagi R., Hall RA., Donowitz M., Hisaminato A., Fujiwara T., Ito Y., Cantley LC., Yaffe MB. no 22-Nov-2013: Contacted by IntAct-Help. partial coverage rapid curation unknown Unknown pull down pull down predetermined predetermined participant predetermined Kanai F., Marignani PA., Sarbassova D., Yagi R., Hall RA., Donowitz M., Hisaminato A., Fujiwara T., Ito Y., Cantley LC., Yaffe MB. no Accepted 2013-NOV-05 by LPERFETTO 22-Nov-2013: Contacted by IntAct-Help. EMBO J. (0261-4189) 2000 partial coverage rapid curation rapid curation runx1_human Runt-related transcription factor 1 RUNX1 AML1 CBFA2 Core-binding factor subunit alpha-2 Acute myeloid leukemia 1 protein Oncogene AML-1 Polyomavirus enhancer-binding protein 2 alpha B subunit SL3-3 enhancer factor 1 alpha B subunit SL3/AKV core-binding factor alpha B subunit protein protein human Homo sapiens Human MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMGSATRYHTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLPNQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY DIP protein Q01196 original sequence version: 171 DIP protein Q01196 original sequence version: 189 DIP protein Q01196 original sequence version: 132 4F1F193A7CADDBAB wwtr1_human WW domain-containing transcription regulator protein 1 Transcriptional coactivator with PDZ-binding motif WWTR1 TAZ protein protein human Homo sapiens Human MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVNPPTMTPDMRSITNNSSDPFLNGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFLDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL 630B50F46FB74C60 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN DIP protein P63104 original sequence version: 144 D464DF2286BBFE60 1433e_sheep 14-3-3 protein epsilon YWHAE Protein kinase C inhibitor protein 1 protein protein sheep Ovis aries (Sheep) Sheep MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner mint 07817CCBD1F75B26 nhrf2_human Na(+)/H(+) exchange regulatory cofactor NHE-RF2 SLC9A3R2 NHERF2 Tyrosine kinase activator protein 1 SRY-interacting protein 1 Solute carrier family 9 isoform A3 regulatory factor 2 NHE3 kinase A regulatory protein E3KARP Sodium-hydrogen exchanger regulatory factor 2 protein protein human Homo sapiens Human MAAPEPLRPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVDPETDEHFKRLRVTPTEEHVEGPLPSPVTNGTSPAQLNGGSACSSRSDLPGSDKDTEDGSAWKQDPFQESGLHLSPTAAEAKEKARAMRVNKRAPQMDWNRKREIFSNF 4F5D341590D22ED7 slc9a3r2-wwtr1 1 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain PDZ BINDING MOTIF range MINT-442154: original sequence: 384-391 : LESEDLIPLFNDVESALNKSEPFLTW tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain range MINT-442164: original sequence: 1-148 : MAAPEPLRPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLREL Stoichiometry: 1.0 colocalization colocalization mint wwtr1-ywhae 1 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed Stoichiometry: 1.0 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain MOTIF:RSHSSP range MINT-442226: original sequence: 86-91 : PRLAGGAQHVRSHSSPASLQLGTGA Stoichiometry: 1.0 colocalization colocalization mint wwtr1-runx1 2 7 unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain MOTIF:PPXY range MINT-442183: original sequence: 339-371 : IGMSAMGSATRYHTYLPPPYPGSSQAQGGPFQ Stoichiometry: 1.0 8 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-442177: original sequence: 165-395 : HMNLHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVNPPTMTPDMRSITNNSSDPFLNGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFLDCLPGTNVDLGTLESEDLIPLFNDVESALNKSE Stoichiometry: 1.0 direct interaction direct interaction mint wwtr1-runx1-1 3 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-442193: original sequence: 165-395 : HMNLHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVNPPTMTPDMRSITNNSSDPFLNGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFLDCLPGTNVDLGTLESEDLIPLFNDVESALNKSE Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain MOTIF:PPXY range MINT-442202: original sequence: 339-371 : IGMSAMGSATRYHTYLPPPYPGSSQAQGGPFQ Stoichiometry: 1.0 physical association physical association mint wwtr1-ywhae-1 4 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain MOTIF:RSHSSP range MINT-442215: original sequence: 86-91 : PRLAGGAQHVRSHSSPASLQLGTGA Stoichiometry: 1.0 physical association physical association mint wwtr1-slc9a3r2 4 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain range MINT-442262: original sequence: 1-148 : MAAPEPLRPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLREL Stoichiometry: 1.0 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain PDZ BINDING MOTIF range MINT-442256: original sequence: 384-391 : LESEDLIPLFNDVESALNKSEPFLTW Stoichiometry: 1.0 physical association physical association mint wwtr1-ywhae-2 5 10 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 8 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain MOTIF:RSHSSP range MINT-442245: original sequence: 86-91 : PRLAGGAQHVRSHSSPASLQLGTGA Stoichiometry: 1.0 direct interaction direct interaction mint wwtr1-ywhaz 6 1433Z_HUMAN 9 unspecified role unspecified role unspecified role unspecified role WWTR1_HUMAN 8 unspecified role unspecified role unspecified role unspecified role association association homomint domino mint