IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Novel ACE2-Independent Carbohydrate-Binding of SARS-CoV-2 Spike Protein to Host Lectins and Lung Microbiota Novel ACE2-Independent Carbohydrate-Binding of SARS-CoV-2 Spike Protein to Host Lectins and Lung Microbiota bioRxiv 2020 imex curation Chiodo F. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review. Results from Supplementary figures have not been entered as the results are illegible. S. pneumoniae CPS: as provided by Finlay Vaccine Institute, Cuba; it is possible the web site had more details of the various CPS from the different serotypes, but if they did, not much use as I do not read Spanish. LPS from P. aeruginosa serotype 10 has a highly variable, and in this instance, unknown structure, thus the O antigen repeat unit (serotype 10) (see pmid:17254386 and 21687428) has been entered here. S. pneumoniae CPS: no specific references are given for the CPS (capsular-polysaccharides) sequences from the various serotypes used here. Thus representative entries for these have been taken from the Chebi database. These are to be regarded as examples of these CPSs rather than definite confirmed sequences. f.chiodo@amsterdamumc.nl 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Chiodo F. Virus - Publications including interactions involving viral proteins This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review. Results from Supplementary figures have not been entered as the results are illegible. S. pneumoniae CPS: as provided by Finlay Vaccine Institute, Cuba; it is possible the web site had more details of the various CPS from the different serotypes, but if they did, not much use as I do not read Spanish. S. pneumoniae CPS: no specific references are given for the CPS (capsular-polysaccharides) sequences from the various serotypes used here. Thus representative entries for these have been taken from the Chebi database. These are to be regarded as examples of these CPSs rather than definite confirmed sequences. LPS from P. aeruginosa serotype 10 has a highly variable, and in this instance, unknown structure, thus the O antigen repeat unit (serotype 10) (see pmid:17254386 and 21687428) has been entered here. f.chiodo@amsterdamumc.nl Accepted 2020-OCT-23 AT 10:02 BST AT 10:02 BST by LUANA bioRxiv 2020 Only protein-protein interactions imex curation imex curation [4)-beta-d-manpnac-(1->4)-alpha-d-glcp-(1->2)-alpha-l-rhap-1-p-(o->]n [4)-beta-D-ManpNAc-(1->4)-alpha-D-Glcp-(1->2)-alpha-L-Rhap-1-P-(O->]n [4)-beta-D-ManNAc-(1->4)-alpha-D-Glc-(1->2)-alpha-L-Rha-1-P-(O->]n Streptococcus pneumoniae serotype 19F pneumococcal polysaccharide small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) sigl9_human Sialic acid-binding Ig-like lectin 9 SIGLEC9 CDw329 Protein FOAP-9 UNQ668/PRO1302 protein protein human Homo sapiens Human MLLLLLPLLWGRERAEGQTSKLLTMQSSVTVQEGLCVHVPCSFSYPSHGWIYPGPVVHGYWFREGANTDQDAPVATNNPARAVWEETRDRFHLLGDPHTKNCTLSIRDARRSDAGRYFFRMEKGSIKWNYKHHRLSVNVTALTHRPNILIPGTLESGCPQNLTCSVPWACEQGTPPMISWIGTSVSPLDPSTTRSSVLTLIPQPQDHGTSLTCQVTFPGASVTTNKTVHLNVSYPPQNLTMTVFQGDGTVSTVLGNGSSLSLPEGQSLRLVCAVDAVDSNPPARLSLSWRGLTLCPSQPSNPGVLELPWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGVVGGAGATALVFLSFCVIFVVVRSCRKKSARPAAGVGDTGIEDANAVRGSASQGPLTEPWAEDSPPDQPPPASARSSVGEGELQYASLSFQMVKPWDSRGQEATDTEYSEIKIHR 807BDCE0D18191F2 [4)-beta-d-glcp-(1->4)-[alpha-l-rhap-(1->2)]-3-o-(2-glycerylphospho)-beta-d-galp-(1->4)-beta-l-rhap-(1->]n [4)-beta-D-Glcp-(1->4)-[alpha-L-Rhap-(1->2)]-3-O-(2-glycerylphospho)-beta-D-Galp-(1->4)-beta-L-Rhap-(1->]n [4)-beta-D-Glc-(1->4)-[alpha-L-Rha-(1->2)]-3-O-(2-glycerylphospho)-beta-D-Gal-(1->4)-beta-L-Rha-(1->]n [4)-beta-D-glucosyl-(1->4)-[alpha-L-rhamnosyl-(1->2)]-3-O-(2-glycerylphospho)-beta-D-galactosyl-(1->4)-beta-L-rhamnosyl-(1->]n S. pneumoniae type 23F capsular polysaccharide [4)-beta-D-glucopyranosyl-(1->4)-[alpha-L-rhamnopyranosyl-(1->2)]-3-O-(2-glycerylphospho)-beta-D-galactopyranosyl-(1->4)-beta-L-rhamnopyranosyl-(1->]n small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) s. pneumoniae serotype 6b cps S. pneumoniae serotype 6B CPS small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) cd209_human CD209 antigen CD209 CLEC4L C-type lectin domain family 4 member L Dendritic cell-specific ICAM-3-grabbing non-integrin 1 protein protein human Homo sapiens Human MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA DIP protein Q9NNX6 original sequence version: 125 DIP protein Q9NNX6 original sequence version: 127 A23FA246014533C0 {4)-[alpha-neup5ac-(2->3)-beta-d-galp-(1->4)-beta-d-glcpnac-(1->6)]-beta-d-glcp-(1->4)-[beta-d-glcp-(1->3)]-beta-d-galp-(1->4)-beta-d-glcp-(1->}n {4)-[alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-beta-D-Glcp-(1->4)-[beta-D-Glcp-(1->3)]-beta-D-Galp-(1->4)-beta-D-Glcp-(1->}n S. pneumoniae type V capsular polysaccharide {4)-[alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->6)]-beta-D-Glc-(1->4)-[beta-D-Glc-(1->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1->}n {4)-[N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl-(1->6)]-beta-D-glucosyl-(1->4)-[beta-D-glucosyl-(1->3)]-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1->}n small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) lps o antigen repeat from p. aeruginosa serotype 10 LPS O antigen repeat from P. aeruginosa serotype 10 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) [3)-alpha-d-fucp4n,nac-(1->4)-alpha-d-galpa-(1->3)-alpha-d-galpa-(1->]n [3)-alpha-D-Fucp4N,NAc-(1->4)-alpha-D-GalpA-(1->3)-alpha-D-GalpA-(1->]n [3)-2-acetamido-4-amino-2,4-dideoxy-alpha-D-fucosyl-(1->4)-alpha-D-galacturonosyl-(1->3)-alpha-D-galacturonosyl-(1->]n [3)-alpha-D-Fuc4N,NAc-(1->4)-alpha-D-GalA-(1->3)-alpha-D-GalA-(1->]n [3)-D-Fuc4N,NAc(alpha1-4)D-GalA(alpha1-3)D-GalA(alpha1-]n S. pneumoniae serotype 1 capsular polysaccharide Streptococcus pneumoniae serotype 1 capsular polysaccharide small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) cd33_human Myeloid cell surface antigen CD33 CD33 SIGLEC3 Sialic acid-binding Ig-like lectin 3 gp67 protein protein human Homo sapiens Human MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHGAIGGAGVTALLALCLCLIFFIVKTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ 1C73E588240FBAD8 clc10_human C-type lectin domain family 10 member A CLEC10A CLECSF13 CLECSF14 HML C-type lectin superfamily member 14 Macrophage lectin 2 protein protein human Homo sapiens Human MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH D3B7193E2E1F58AF s. pneumoniae serotype 18c cps S. pneumoniae serotype 18C CPS small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) spike_sars2 Spike glycoprotein S E2 Peplomer protein 2 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT sig10_human Sialic acid-binding Ig-like lectin 10 SIGLEC10 SLG2 Siglec-like protein 2 UNQ477/PRO940 protein protein human Homo sapiens Human MLLPLLLSSLLGGSQAMDGRFWIRVQESVMVPEGLCISVPCSFSYPRQDWTGSTPAYGYWFKAVTETTKGAPVATNHQSREVEMSTRGRFQLTGDPAKGNCSLVIRDAQMQDESQYFFRVERGSYVRYNFMNDGFFLKVTALTQKPDVYIPETLEPGQPVTVICVFNWAFEECPPPSFSWTGAALSSQGTKPTTSHFSVLSFTPRPQDHNTDLTCHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYLEAQKGQFLRLLCAADSQPPATLSWVLQNRVLSSSHPWGPRPLGLELPGVKAGDSGRYTCRAENRLGSQQRALDLSVQYPPENLRVMVSQANRTVLENLGNGTSLPVLEGQSLCLVCVTHSSPPARLSWTQRGQVLSPSQPSDPGVLELPRVQVEHEGEFTCHARHPLGSQHVSLSLSVHYSPKLLGPSCSWEAEGLHCSCSSQASPAPSLRWWLGEELLEGNSSQDSFEVTPSSAGPWANSSLSLHGGLSSGLRLRCEAWNVHGAQSGSILQLPDKKGLISTAFSNGAFLGIGITALLFLCLALIIMKILPKRRTQTETPRPRFSRHSTILDYINVVPTAGPLAQKRNQKATPNSPRTPLPPGAPSPESKKNQKKQYQLPSFPEPKSSTQAPESQESQEELHYATLNFPGVRPRPEARMPKGTQADYAEVKFQ mint E1B787F34CF7201A s-cd209-2 1 13 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 6 unspecified role unspecified role prey prey purified purified region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction 1 s-clec10a-1 1 13 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 11 unspecified role unspecified role prey prey purified purified region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction 1 s-cd33-1 1 13 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 unspecified role unspecified role prey prey purified purified C-terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc direct interaction direct interaction 2 s-siglec9-1 1 13 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 3 unspecified role unspecified role prey prey purified purified C-terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc direct interaction direct interaction 2 s-siglec9-2 1 14 unspecified role unspecified role prey prey purified purified C-terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc 13 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 2 [4)_beta_d_manpnac_(1_>4)_alpha_d_glcp_(1_>2)_alpha_l_rhap_1_p_(o_>]n-1 1 13 unspecified role unspecified role prey prey purified purified C-terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 2 unspecified role unspecified role bait bait purified purified direct interaction direct interaction 3, number 1 Sp19F:strong binding s-52 1 13 unspecified role unspecified role prey prey purified purified rbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 12 unspecified role unspecified role bait bait purified purified direct interaction direct interaction 3, number 2 Sp18C:weaker binding [3)_alpha_d_fucp4n,nac_(1_>4)_alpha_d_galpa_(1_>3)_alpha_d_galpa_(1_>]n-1 1 13 unspecified role unspecified role prey prey purified purified rbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 9 unspecified role unspecified role bait bait purified purified direct interaction direct interaction 3, number 3 Sp1: very weak binding [4)_beta_d_glcp_(1_>4)_[alpha_l_rhap_(1_>2)]_3_o_(2_glycerylphospho)_beta_d_galp_(1_>4)_beta_l_rhap_(1_>]n-s-1 1 13 unspecified role unspecified role prey prey purified purified rbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 4 unspecified role unspecified role bait bait purified purified direct interaction direct interaction 3, number 4 Sp23F:strong binding s. pneumoniae serotype 6b cps-s-1 1 13 unspecified role unspecified role prey prey purified purified rbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 5 unspecified role unspecified role bait bait purified purified direct interaction direct interaction 3, number 5 Sp6B:weaker binding {4)_[alpha_neup5ac_(2_>3)_beta_d_galp_(1_>4)_beta_d_glcpnac_(1_>6)]_beta_d_glcp_(1_>4)_[beta_d_glcp_(1_>3)]_beta_d_galp_(1_>4)_beta_d_glcp_(1_>}n-s-1 1 13 unspecified role unspecified role prey prey purified purified rbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 7 unspecified role unspecified role bait bait purified purified direct interaction direct interaction 3, number 6 Sp5: very weak binding s. pneumoniae serotype 6b cps-s-2 1 13 unspecified role unspecified role prey prey purified purified rbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 unspecified role unspecified role bait bait purified purified direct interaction direct interaction 4 Sp6B:weaker binding