MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Characterization of the interactions among vaccinia virus transcription factors G2R, A18R, and H5R. Characterization of the interactions among vaccinia virus transcription factors G2R, A18R, and H5R. Virology (0042-6822) 1998 rapid curation Black EP., Moussatche N., Condit RC. Virus - Publications including interactions involving viral proteins suggested by panni rapid curation unknown Unknown pull down pull down predetermined predetermined participant predetermined Black EP., Moussatche N., Condit RC. Virus - Publications including interactions involving viral proteins suggested by panni Virology (0042-6822) 1998 rapid curation rapid curation Characterization of the interactions among vaccinia virus transcription factors G2R, A18R, and H5R. Characterization of the interactions among vaccinia virus transcription factors G2R, A18R, and H5R. Virology (0042-6822) 1998 rapid curation Black EP., Moussatche N., Condit RC. Virus - Publications including interactions involving viral proteins suggested by panni rapid curation unknown Unknown 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Black EP., Moussatche N., Condit RC. Virus - Publications including interactions involving viral proteins suggested by panni Virology (0042-6822) 1998 rapid curation rapid curation Characterization of the interactions among vaccinia virus transcription factors G2R, A18R, and H5R. Characterization of the interactions among vaccinia virus transcription factors G2R, A18R, and H5R. Virology (0042-6822) 1998 rapid curation Black EP., Moussatche N., Condit RC. Virus - Publications including interactions involving viral proteins suggested by panni rapid curation unknown Unknown anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Black EP., Moussatche N., Condit RC. Virus - Publications including interactions involving viral proteins suggested by panni Virology (0042-6822) 1998 rapid curation rapid curation h5_vaccw Late transcription elongation factor H5 Viral late gene transcription factor 4 H5R VACWR103 protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MAWSITNKADTSSFTKMAEIRAHLKNSAENKDKNEDIFPEDVIIPSTKPKTKRATTPRKPAATKRSTKKEEVEEEVVIEEYHQTTEKNSPSPGVSDIVESVAAVELDDSDGDDEPMVQVEAGKVNHSARSDLSDLKVATDNIVKDLKKIITRISAVSTVLEDVQAAGISRQFTSMTKAITTLSDLVTEGKSKVVRKKVKTCKK mint 89B54D5DFD976B7D a18_vaccw Transcript termination protein A18 A18R VACWR138 56 kDa abortive late protein protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MSLLKMEYNLYAELKKMTCGQPLSLFNEDGDFVEVEPGSSFKFLIPKGFYASPSVKTSLVFETLTTTDNKITSINPTNAPKLYPLQRKVVSEVVSNMRKMIESKRPLYITLHLACGFGKTITTCYLMATHGRKTVICVPNKMLIHQWKTQVEAVGLEHKISIDGVSSLLKELKTQSPDVLIVVSRHLTNDAFCKYINKHYDLFILDESHTYNLMNNTAVTRFLAYYPPMMCYFLTATPRPANRIYCNSIINIAKLSDLKKTIYAVDSFFEPYSTDNIRHMVKRLDGPSNKYHIYTEKLLSVDEPRNQLILNTLVEEFKSGTINRILVITKLREHMVLFYKRLLDLFGPEVVFIGDAQNRRTPDMVKSIKELNRFIFVSTLFYSGTGLDIPSLDSLFICSAVINNMQIEQLLGRVCRETELLDRTVYVFPNTSIKEIKYMIGNFMQRIISLSVDKLGFKQESYRKHQESDPTSVCTTSSREERVLNRIFNSQNR Prevents virus-induced breakdown of RNA. Acts as a negative transcription elongation factor. Involved in an ATP-dependent manner in release of nascent RNA mint DCFB6514B3DE081A g2_vaccw Late transcription elongation factor G2 G2R VACWR080 Protein G2 protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MPFRDLILFNLSKFLLTEDEESLEIVSSLCRGFEISYDDLITYFPDRKYHKYISKVFEHVDLSEELSMEFHDTTLRDLVYLRLYKYSKCIRPCYKLGDNLKGIVVIKDRNIYIREANDDLIEYLLKEYTPQIYTYSNERVPITGSKLILCGFSQVTFMAYTTSHITTNKKVDVLVSKKCIDELVDPINYQILQNLFDKGSGTINKILRKIFYSVTGGQTP mint The inactivation of this protein renders the virus dependent upon isatin-beta-thiosemicarbazone (IBT) for growth FA97B1E8F419D1A2 g2-h5 2 6 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component physical association physical association T1 homomint mint a18-g2 3 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association F3 homomint mint h5-g2-1 3 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association F3 homomint mint h5-a18 3 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association F3 homomint mint g2-h5-1 1 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association F3 homomint mint