MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Homologous regions of the alpha subunit of eukaryotic translational initiation factor 2 (eIF2alpha) and the vaccinia virus K3L gene product interact with the same domain within the dsRNA-activated protein kinase (PKR). Homologous regions of the alpha subunit of eukaryotic translational initiation factor 2 (eIF2alpha) and the vaccinia virus K3L gene product interact with the same domain within the dsRNA-activated protein kinase (PKR). Eur. J. Biochem. (0014-2956) 1997 rapid curation Sharp TV., Witzel JE., Jagus R. Virus - Publications including interactions involving viral proteins suggested by panni rapid curation unknown Unknown protein kinase assay protein kinase assay predetermined predetermined participant predetermined Sharp TV., Witzel JE., Jagus R. Virus - Publications including interactions involving viral proteins suggested by panni Eur. J. Biochem. (0014-2956) 1997 rapid curation rapid curation Homologous regions of the alpha subunit of eukaryotic translational initiation factor 2 (eIF2alpha) and the vaccinia virus K3L gene product interact with the same domain within the dsRNA-activated protein kinase (PKR). Homologous regions of the alpha subunit of eukaryotic translational initiation factor 2 (eIF2alpha) and the vaccinia virus K3L gene product interact with the same domain within the dsRNA-activated protein kinase (PKR). Eur. J. Biochem. (0014-2956) 1997 rapid curation Sharp TV., Witzel JE., Jagus R. Virus - Publications including interactions involving viral proteins suggested by panni rapid curation unknown Unknown competition binding competition binding predetermined predetermined participant predetermined Sharp TV., Witzel JE., Jagus R. Virus - Publications including interactions involving viral proteins suggested by panni Eur. J. Biochem. (0014-2956) 1997 rapid curation rapid curation Homologous regions of the alpha subunit of eukaryotic translational initiation factor 2 (eIF2alpha) and the vaccinia virus K3L gene product interact with the same domain within the dsRNA-activated protein kinase (PKR). Homologous regions of the alpha subunit of eukaryotic translational initiation factor 2 (eIF2alpha) and the vaccinia virus K3L gene product interact with the same domain within the dsRNA-activated protein kinase (PKR). Eur. J. Biochem. (0014-2956) 1997 rapid curation Sharp TV., Witzel JE., Jagus R. Virus - Publications including interactions involving viral proteins suggested by panni rapid curation unknown Unknown anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Sharp TV., Witzel JE., Jagus R. Virus - Publications including interactions involving viral proteins suggested by panni Eur. J. Biochem. (0014-2956) 1997 rapid curation rapid curation if2a_human Eukaryotic translation initiation factor 2 subunit 1 EIF2S1 EIF2A Eukaryotic translation initiation factor 2 subunit alpha protein protein human Homo sapiens Human MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSINKLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLEYTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNINRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTTTLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEVDGDDDAEEMEAKAED DIP protein P05198 original sequence version: 149 FF3E75E3816E6B1E k3_vaccc Protein K3 K3L protein protein vaccc Vaccinia virus (strain Copenhagen) (VACV) VACV MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHSEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ DIP protein P20639 original sequence version: 63 Plays an integral role in the resistance of the virus to interferon. May bind competitively to the P1 kinase to block eIF-2-alpha phosphorylation mint 196AD69CD94AE4F0 e2ak2_human Interferon-induced, double-stranded RNA-activated protein kinase Interferon-inducible RNA-dependent protein kinase Eukaryotic translation initiation factor 2-alpha kinase 2 Protein kinase RNA-activated p68 kinase P1/eIF-2A protein kinase EIF2AK2 PKR PRKR Tyrosine-protein kinase EIF2AK2 protein protein human Homo sapiens Human MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSGSFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAKRSLAPRFDLPDMKETKYTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC DIP protein P19525 original sequence version: 164 DIP protein P19525-1 original sequence version: 177 DIP protein P19525-1 original sequence version: 178 DIP protein P19525-1 original sequence version: 170 DIP protein P19525 original sequence version: 153 815AD83ACAB45DA3 eif2ak2-k3 3 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association F2 F6 homomint mint eif2ak2-eif2s1 3 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association F2 F6 homomint mint eif2ak2-k3-1 2 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association F3 F4 homomint mint eif2ak2-eif2s1-1 2 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association F3 F4 homomint mint eif2ak2-eif2s1-2 1 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait phosphorylation phosphorylation reaction phosphorylation F5 homomint mint