MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Interaction of the bovine papillomavirus E6 protein with the clathrin adaptor complex AP-1. Interaction of the bovine papillomavirus E6 protein with the clathrin adaptor complex AP-1. J. Virol. (0022-538X) 1998 Tong X., Boll W., Kirchhausen T., Howley PM. Virus - Publications including interactions involving viral proteins in vitro In vitro pull down pull down predetermined predetermined participant predetermined Tong X., Boll W., Kirchhausen T., Howley PM. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 1998 ve6_bpv1 Protein E6 E6 protein protein bpv1 Bovine papillomavirus type 1 MDLKPFARTNPFSGLDCLWCREPLTEVDAFRCMVKDFHVVIREGCRYGACTICLENCLATERRLWQGVPVTGEEAELLHGKTLDRLCIRCCYCGGKLTKNEKHRHVLFNEPFCKTRANIIRGRCYDCCRHGSRSKYP DIP protein P06931 original sequence version: 84 mint Transcriptional transactivator. Binds double stranded DNA 36FADDDA55444566 ap1m1_human AP-1 complex subunit mu-1 Golgi adaptor HA1/AP1 adaptin mu-1 subunit Mu-adaptin 1 AP-mu chain family member mu1A Mu1A-adaptin Clathrin coat assembly protein AP47 Clathrin coat-associated protein AP47 Adaptor protein complex AP-1 subunit mu-1 Clathrin assembly protein complex 1 mu-1 medium chain 1 AP1M1 CLTNM Adaptor-related protein complex 1 subunit mu-1 protein protein human Homo sapiens Human MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRTQ 64EC5E47EA6F8E98 ap2b1_bovin AP-2 complex subunit beta AP2B1 CLAPB1 Beta-adaptin Plasma membrane adaptor HA2/AP2 adaptin beta subunit Clathrin assembly protein complex 2 beta large chain AP105B Beta-2-adaptin Adaptor protein complex AP-2 subunit beta Adaptor-related protein complex 2 subunit beta protein protein bovin Bos taurus (Bovine) Bovine MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKESDYYNMLLKKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGLDSLVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN DIP protein P63009 original sequence version: 50 Component of the adaptor complexes which link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration. AP2B1 is a subunit of the plasma membrane adaptor. The complex binds polyphosphoinositides mint 1BE161EF3B8C07A3 q9ts83_bovin protein protein bovin Bos taurus (Bovine) Bovine KGEIFELKAELNSDKKEKSQPDMAIMAVNTFVKDXEDPNPLEAQSIXERVTPRLSHANSAVVLSAVKVLMKFMEMLXKVFFVKYNDPIYVKLEKLDTASSESTESPETAPAGAPPGEQLDAVPXQGDLDLLNLDLGPPVSGPPLAASAVQMGAVDLLGGGLDSLIGAPSFVAPPAAAVPANLGDXPLNAEAVSSRLQSSNIFTVARRNVEGQ mint C16D8A8F0E44BF4E e6-q9ts83 1 5 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 2 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:23:17 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing ' range MINT-1530335: original sequence: 105-105 : GKLTKNEKHRHVLFNEPFCK Stoichiometry: 1.0 direct interaction direct interaction F1B F2 mint ap2b1-ap1m1 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:24:42 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing ' range MINT-1530312: original sequence: 134-137 : EPLRKCLKDEDPYVRKTAAVCVA range MINT-1530313: original sequence: 105-105 : CEDPNPLIRALAVRTMGCIR Stoichiometry: 1.0 3 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction F2 mint