HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Interaction between hepatitis C virus core protein and E1 envelope protein. Interaction between hepatitis C virus core protein and E1 envelope protein. J. Virol. (0022-538X) 1996 imex curation Lo S.Y., Selby M.J., Ou J.H. Virus - Publications including interactions involving viral proteins Only protein-protein interactions imex curation chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Lo S.Y., Selby M.J., Ou J.H. Virus - Publications including interactions involving viral proteins Accepted 2013-AUG-14 by ORCHARD J. Virol. (0022-538X) 1996 imex curation Interaction between hepatitis C virus core protein and E1 envelope protein. Interaction between hepatitis C virus core protein and E1 envelope protein. J. Virol. (0022-538X) 1996 imex curation Lo S.Y., Selby M.J., Ou J.H. Virus - Publications including interactions involving viral proteins Only protein-protein interactions imex curation chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Lo S.Y., Selby M.J., Ou J.H. Virus - Publications including interactions involving viral proteins Accepted 2013-AUG-14 by ORCHARD J. Virol. (0022-538X) 1996 imex curation p27958-pro_0000037569 Envelope glycoprotein E1 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) YQVRNSSGLYHVTNDCPNSSVVYEAADAILHTPGCVPCVREGNASRCWVAVTPTVATRDGKLPTTQLRRHIDLLVGSATLCSALYVGDLCGSVFLVGQLFTFSPRHHWTTQDCNCSIYPGHITGHRMAWNMMMNWSPTAALVVAQLLRIPQAIMDMIAGAHWGVLAGIKYFSMVGNWAKVLVVLLLFAGVDA 192 383 62EDCA90D2CEBCE8 p27958-pro_0000037566 Core protein precursor protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) STNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRPEGRTWAQPGYPWPLYGNEGCGWAGWLLSPRGSRPSWGPTDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTVPASA 2 191 7C9059C0D1D2732E p27958_pr-p27958_p-3 2 E1 3 unspecified role unspecified role prey prey tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Core 4 unspecified role unspecified role bait bait tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1,2 and 4 p27958_pr-p27958_p-4 1 Core 4 unspecified role unspecified role neutral component neutral component tpa tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined E1 3 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 3